DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and TXN

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_003320.2 Gene:TXN / 7295 HGNCID:12435 Length:105 Species:Homo sapiens


Alignment Length:98 Identity:29/98 - (29%)
Similarity:45/98 - (45%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 DKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPT 231
            ||||       :|:|.|.|||.||.:.|.:...:::....:.| .:|....|..|:|..|:..||
Human    20 DKLV-------VVDFSATWCGPCKMIKPFFHSLSEKYSNVIFL-EVDVDDCQDVASECEVKCMPT 76

  Fly   232 IKFFPAGSKRASDAQEYDGGR------TASDIV 258
            .:||..|.|    ..|:.|..      |.:::|
Human    77 FQFFKKGQK----VGEFSGANKEKLEATINELV 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 29/98 (30%)
Thioredoxin_6 190..383 CDD:290560 18/75 (24%)
P5_C 271..400 CDD:239281
TXNNP_003320.2 TRX_family 11..102 CDD:239245 28/93 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.