DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Erp27

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:271 Identity:49/271 - (18%)
Similarity:86/271 - (31%) Gaps:88/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKA 221
            ||.|.|    |.|....:.|||.:                               :.||.....|
Mouse    26 DVEEAT----DGLSTTQEPIWLTD-------------------------------VPATVELIAA 55

  Fly   222 AEYNVRGY------PTIKFFPAGSKRASDAQ-----------EYDGGRTASDIVSWASDKH---- 265
            ||..|.|:      |.:..|.:.:::..|..           .|:....:..:.....|:.    
Mouse    56 AEVAVIGFFQDLEIPIVSVFRSMARQFQDVSFGISNHSEVLTHYNVTSNSICLFRLVDDQQLHLN 120

  Fly   266 ---VANVPAPELIEIINESTFETACEGKPLCVVS-----VLPHILDCDAKCRNKFLDTLRTLGE- 321
               :.|:.|.:|...|:.:......|..|:....     |..|:|....|...::.:::|...| 
Mouse   121 AEDIENLDAAKLSRFIHVNNLHWVTEYSPMIAAGLFNTMVQTHLLLMMKKTSPEYEESMRRYREA 185

  Fly   322 -KFKQKQWGWAWAEGGQQ------------------LALEESLEVGGFGYPAMAVVNFKKMK--- 364
             |..|.|..:...:.|::                  ||:.||::......| :|.|..:|::   
Mouse   186 AKLFQGQILFVLVDSGKRENGKVMSYFKLKESQLPALAIYESVDDKWDTLP-IAEVTVEKVRGFC 249

  Fly   365 FSVLKGSFSKD 375
            ...|||...:|
Mouse   250 EGFLKGLLQRD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 20/121 (17%)
Thioredoxin_6 190..383 CDD:290560 40/238 (17%)
P5_C 271..400 CDD:239281 27/133 (20%)
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:372755 29/186 (16%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.