Sequence 1: | NP_001285979.1 | Gene: | CaBP1 / 34976 | FlyBaseID: | FBgn0025678 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102929.1 | Gene: | LOC685171 / 685171 | RGDID: | 1597712 | Length: | 139 | Species: | Rattus norvegicus |
Alignment Length: | 141 | Identity: | 58/141 - (41%) |
---|---|---|---|
Similarity: | 77/141 - (54%) | Gaps: | 9/141 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 LVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAE 125
Fly 126 AALAEVKKKVQGVLGGGGGSSSGG----SGSSSGDDVIELTEDNFDKLVLNSDD-IWLVEFFAPW 185
Fly 186 CGHCKNLAPEW 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CaBP1 | NP_001285979.1 | PDI_a_P5 | 26..119 | CDD:239299 | 30/57 (53%) |
PDI_a_P5 | 157..262 | CDD:239299 | 18/41 (44%) | ||
Thioredoxin_6 | 190..383 | CDD:290560 | 5/7 (71%) | ||
P5_C | 271..400 | CDD:239281 | |||
LOC685171 | NP_001102929.1 | Thioredoxin_like | <2..68 | CDD:294274 | 33/66 (50%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D290413at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000934 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100473 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |