DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and LOC685171

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001102929.1 Gene:LOC685171 / 685171 RGDID:1597712 Length:139 Species:Rattus norvegicus


Alignment Length:141 Identity:58/141 - (41%)
Similarity:77/141 - (54%) Gaps:9/141 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LVPEYKKLAKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAE 125
            |.||:||.|..|:. |||.:|:|....:|..|:||:||||||||||:|..|..|.|.||.:|..:
  Rat     2 LTPEWKKAATVLRD-VKVRAVDAGRHQSLGDQYGVQGFPTIKIFGASKTKPEYYQGGRTREATVD 65

  Fly   126 AALAEVKKKVQGVLGGGGGSSSGG----SGSSSGDDVIELTEDNFDKLVLNSDD-IWLVEFFAPW 185
            .||:.:.:.::..||........|    ..||...|::|||:|.||..||.... :||...|.  
  Rat    66 VALSALHQLLKDCLGRHSSVYCSGKQVKGDSSCKKDMVELTDDTFDYNVLVVKTLVWLDFMFH-- 128

  Fly   186 CGHCKNLAPEW 196
             |...||.|||
  Rat   129 -GVDINLEPEW 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 30/57 (53%)
PDI_a_P5 157..262 CDD:239299 18/41 (44%)
Thioredoxin_6 190..383 CDD:290560 5/7 (71%)
P5_C 271..400 CDD:239281
LOC685171NP_001102929.1 Thioredoxin_like <2..68 CDD:294274 33/66 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290413at33208
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100473
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.