DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Tmx3

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_038953303.1 Gene:Tmx3 / 682967 RGDID:1592777 Length:470 Species:Rattus norvegicus


Alignment Length:287 Identity:81/287 - (28%)
Similarity:123/287 - (42%) Gaps:82/287 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELK---GKVKLGALDATAH 217
            :|:.|..:||      ..||||||:|:||||||||.|.|.|.:...|:|   ..||:|.:|||::
  Rat    46 EDLNESFKDN------RKDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSY 104

  Fly   218 QSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWA---SDKHVANVPAPELIEIIN 279
            .|.|:|:.||||||||..     :...|..|.|.||..||:.:|   |...:..:|:.::.:.:.
  Rat   105 SSIASEFGVRGYPTIKLL-----KGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFDHVR 164

  Fly   280 E--STFETACEGK-PLCVVSVLPHILDCDAKCRNKFLDTLR--------------------TLGE 321
            :  ..|.....|: ||                :.|::|...                    ||.|
  Rat   165 KRHRVFFVYIGGESPL----------------KEKYIDAASELIVYTYFFSASEDVVPEYVTLKE 213

  Fly   322 K-----FKQKQW------------GWAWAEGGQQ-LALEESL--EVGGFG-YPAMAVVNFK--KM 363
            .     ||...:            .|...|..|. |.::..|  |:|..| ..|:||::.|  .:
  Rat   214 MPAVLVFKDDTYFVYDEYEDGDLSSWISRERFQNYLTMDGFLLYELGDTGKLVAIAVIDEKNTSL 278

  Fly   364 KFSVLKG---SFSKDGINEFLRDISYG 387
            :.:.||.   ..::|..:.|.||..:|
  Rat   279 EHTRLKSIIQEVARDFRDHFHRDFQFG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 49/110 (45%)
Thioredoxin_6 190..383 CDD:290560 60/247 (24%)
P5_C 271..400 CDD:239281 30/166 (18%)
Tmx3XP_038953303.1 PDI_a_TMX3 44..147 CDD:239298 49/111 (44%)
ER_PDI_fam 46..>361 CDD:273457 81/287 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.