DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and TXNDC16

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_065835.2 Gene:TXNDC16 / 57544 HGNCID:19965 Length:825 Species:Homo sapiens


Alignment Length:330 Identity:72/330 - (21%)
Similarity:119/330 - (36%) Gaps:88/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG--VVKVGSVNADA 85
            |.:..||||...|:..|:..|:|  |.|||.|.....:.:..|..:|..|||  .:.:..:|...
Human   389 PLELTVELTEETFNATVMASDSI--VLFYAGWQAVSMAFLQSYIDVAVKLKGTSTMLLTRINCAD 451

  Fly    86 DSTLSGQFGVRGFPTIKIFGANKK--SPTDYNG-------------QRTAKAIAEAALAEVKKKV 135
            .|.:..:..|..||.||::   ||  :|..|.|             .|.:..:...::.|.::.:
Human   452 WSDVCTKQNVTEFPIIKMY---KKGENPVSYAGMLGTEDLLKFIQLNRISYPVNITSIQEAEEYL 513

  Fly   136 QGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAA 200
            .|                      ||.:|    |:|.| .:.::..|:|   ..|....::::|.
Human   514 SG----------------------ELYKD----LILYS-SVSVLGLFSP---TMKTAKEDFSEAG 548

  Fly   201 KELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKH 265
            ..|||.|..|..........:.:|            |.|..|.....:..|:..|        ..
Human   549 NYLKGYVITGIYSEEDVLLLSTKY------------AASLPALLLARHTEGKIES--------IP 593

  Fly   266 VANVPAPELIEIINESTFETACEGKPLCVVSVLPH---------ILDCDAKCRNKFLDTLRTLGE 321
            :|:..|.::::||.::..|..    |...|..||.         ||..|.....::...:.||  
Human   594 LASTHAQDIVQIITDALLEMF----PEITVENLPSYFRLQKPLLILFSDGTVNPQYKKAILTL-- 652

  Fly   322 KFKQK 326
             .|||
Human   653 -VKQK 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 30/109 (28%)
PDI_a_P5 157..262 CDD:239299 21/104 (20%)
Thioredoxin_6 190..383 CDD:290560 30/146 (21%)
P5_C 271..400 CDD:239281 16/65 (25%)
TXNDC16NP_065835.2 PDI_a_family 394..492 CDD:239259 30/102 (29%)
Thioredoxin_6 533..722 CDD:290560 32/154 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..787
Mediates endoplasmic reticulum retention. /evidence=ECO:0000269|PubMed:25122923 816..819
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.