DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and dnajc10

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001077016.1 Gene:dnajc10 / 557858 ZFINID:ZDB-GENE-070327-1 Length:791 Species:Danio rerio


Alignment Length:271 Identity:80/271 - (29%)
Similarity:132/271 - (48%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVELTPSNFDREV--LKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTL 89
            ||.|.|.:|...|  .|....|:|:|||||||.||:|:||::::|:.|.|:|.||:|:.....:.
Zfish   554 VVTLGPESFQELVKRRKSSETWMVDFYAPWCGPCQALLPEWRRMARMLSGIVNVGTVDCQKHHSF 618

  Fly    90 SGQFGVRGFPTIKIFGAN---KKSPTDYNG-QRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGS 150
            .....||.:|.|::|..|   :.....||| .|.|.::...||:.:.:.                
Zfish   619 CQSESVRAYPEIRLFPQNSNRRDQYQTYNGWHRDAFSLKAWALSSLPRA---------------- 667

  Fly   151 GSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDAT 215
                   .::|:.::|.:.||...|.|:::|:|||||.|:..|||:...|:.:||.|:.|.:|..
Zfish   668 -------SVDLSPEDFKRKVLGGKDHWVLDFYAPWCGPCQQFAPEFEVLARMMKGTVRAGKVDCQ 725

  Fly   216 AHQSKAAEYNVRGYPTIKFFPA-GSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIIN 279
            ||........::.|||::|:|. |:.|.....|:...|.|:.|.                 :|:.
Zfish   726 AHYQTCQSAGIKAYPTVRFYPTLGTTRRDQGGEHINSRDATVIA-----------------DILR 773

  Fly   280 ESTFETACEGK 290
            :...:.|.:||
Zfish   774 QRLQQLALQGK 784

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 37/97 (38%)
PDI_a_P5 157..262 CDD:239299 35/105 (33%)
Thioredoxin_6 190..383 CDD:290560 26/102 (25%)
P5_C 271..400 CDD:239281 4/20 (20%)
dnajc10NP_001077016.1 DnaJ 33..>129 CDD:223560
DnaJ 33..95 CDD:278647
PDI_a_ERdj5_N 128..228 CDD:239301
ER_PDI_fam 129..648 CDD:273457 35/93 (38%)
Thioredoxin_like <276..318 CDD:294274
PDI_a_family 348..443 CDD:239259
PDI_a_ERdj5_C 450..546 CDD:239302
PDI_a_ERdj5_C 552..660 CDD:239302 39/105 (37%)
PDI_a_ERdj5_C 666..772 CDD:239302 35/145 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2193
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.