DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and txndc16

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:XP_685017.4 Gene:txndc16 / 556973 ZFINID:ZDB-GENE-100712-1 Length:804 Species:Danio rerio


Alignment Length:226 Identity:56/226 - (24%)
Similarity:87/226 - (38%) Gaps:60/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGV--VKVGSVNADADSTL 89
            |.|||...| :..:|.:.|.||.||..|...|.:.:..|.::|:|::.|  |::.:|:....:.:
Zfish   388 VTELTADTF-QTAIKQNEITVVLFYFKWDAVCMAFIQSYVEVAEAVEDVNGVELAAVDCGEWTDI 451

  Fly    90 SGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAAL-------------AEVKKKVQG---- 137
            .....:..|||:.|:.....:...|.|....|::....|             |||...::|    
Zfish   452 CRDQNITSFPTVLIYCPKAAAAQPYRGMMGTKSLQRFILLSLVSTPVHLSSSAEVMSFLEGDLYR 516

  Fly   138 ---------VLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLA 193
                     ||  |..||....|.||.::...|         |..:.|  :..||    |     
Zfish   517 KYVYLTPVRVL--GLFSSMQDMGVSSFEEAARL---------LRGETI--IGLFA----H----- 559

  Fly   194 PEWAKAAKELKG-KVKLGAL-----DATAHQ 218
               .:|||.::| .|.|.||     .|..||
Zfish   560 ---KEAAKWVEGLSVNLPALLVSHGPALPHQ 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 25/93 (27%)
PDI_a_P5 157..262 CDD:239299 17/68 (25%)
Thioredoxin_6 190..383 CDD:290560 11/35 (31%)
P5_C 271..400 CDD:239281
txndc16XP_685017.4 PDI_a_family 389..489 CDD:239259 25/100 (25%)
Thioredoxin_6 530..722 CDD:290560 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.