DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and tmx3b

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001039026.1 Gene:tmx3b / 553250 ZFINID:ZDB-GENE-060901-5 Length:484 Species:Danio rerio


Alignment Length:402 Identity:93/402 - (23%)
Similarity:148/402 - (36%) Gaps:142/402 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELK---GKVKLGALDATAHQS 219
            |::| :|:|..  ...:|:|||:|:|||||:||.|.|.|.:...||.   ..|::|.:||||:..
Zfish    21 VLDL-DDSFKD--SRMEDVWLVDFYAPWCGYCKKLEPVWEEVGAELSRSGSPVRVGKMDATAYSG 82

  Fly   220 KAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWA---SDKHVANVPAPELIEII--- 278
            .|:|:.||||||||..     :...|..|.|.||..||:.:|   :...|..:|:.::.|.:   
Zfish    83 MASEFGVRGYPTIKLL-----KGDLAYNYKGPRTKDDIIEFANRVAGPAVRALPSRQMFEHVLKR 142

  Fly   279 --------------NESTFETACE-----------GKPLCVVSVLPH----ILDCDAKC------ 308
                          .|...|.|.|           .:.|....|||.    ::..||..      
Zfish   143 HSVLFLYVGGESPLKEKYIEVASELIVYTYFFSASEEVLTEAVVLPELPSVVVFKDASFFTYDEY 207

  Fly   309 ----------RNKF-----LD--TLRTLGEKFK-------------------------------- 324
                      |.:|     :|  ||..|||..|                                
Zfish   208 EDGSLSSWVNRERFQSYLQIDGFTLYELGETGKLVAIAVTDDKDQSDHSSRLKGLIQRVATEHRE 272

  Fly   325 --QKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKF------------------SVLK 369
              .:.:.:....|...:   .||.:|....|::.::|....::                  |||.
Zfish   273 QFNRDFQFGHMSGNDYI---NSLIMGEVSIPSIIILNTSNEQYFLPAEPVEDLQQMLQFFSSVLD 334

  Fly   370 GS---FSKDGINEFLRDISYGRGHT-------APVRG----AKKPAIVSVDPWDGKDGQLPTEED 420
            ||   :..|||.:.::.::|....|       :|:.|    .....::|:..:    |....|.|
Zfish   335 GSAPAYGGDGIFQRIKRVAYDARSTIMSVFRSSPLLGCFLFGLPLGVISLMCY----GICTAESD 395

  Fly   421 IDLSDIDLDKDE 432
            ....|::|.|.|
Zfish   396 DGTEDLELMKAE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 45/109 (41%)
Thioredoxin_6 190..383 CDD:290560 66/308 (21%)
P5_C 271..400 CDD:239281 38/249 (15%)
tmx3bNP_001039026.1 PDI_a_TMX3 27..123 CDD:239298 42/102 (41%)
Thioredoxin_6 153..328 CDD:290560 25/177 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.