Sequence 1: | NP_001285979.1 | Gene: | CaBP1 / 34976 | FlyBaseID: | FBgn0025678 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083424.1 | Gene: | Tmx4 / 52837 | MGIID: | 106558 | Length: | 335 | Species: | Mus musculus |
Alignment Length: | 196 | Identity: | 48/196 - (24%) |
---|---|---|---|
Similarity: | 77/196 - (39%) | Gaps: | 33/196 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 ILLLAFVVGSV------SAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEY 65
Fly 66 KKLAKALKGV-VKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALA 129
Fly 130 EVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIW-LVEFFA------PWCG 187
Fly 188 H 188 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CaBP1 | NP_001285979.1 | PDI_a_P5 | 26..119 | CDD:239299 | 30/93 (32%) |
PDI_a_P5 | 157..262 | CDD:239299 | 10/39 (26%) | ||
Thioredoxin_6 | 190..383 | CDD:290560 | |||
P5_C | 271..400 | CDD:239281 | |||
Tmx4 | NP_083424.1 | Thioredoxin_like | 33..133 | CDD:294274 | 30/104 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 222..316 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |