DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and pdia6

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001007974.1 Gene:pdia6 / 493341 XenbaseID:XB-GENE-974680 Length:441 Species:Xenopus tropicalis


Alignment Length:441 Identity:259/441 - (58%)
Similarity:320/441 - (72%) Gaps:24/441 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVGSV--------SAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLA 69
            |:|:|        ||.|||||.|:|||||||::||::.|::|:||||||||||||.|.|::||.|
 Frog     5 VLGAVACTLFMAASAMYSPSDDVIELTPSNFNKEVIQSDSLWLVEFYAPWCGHCQRLTPDWKKAA 69

  Fly    70 KALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKK 134
            .|||||||:|:||||...:|.||:|||||||||:|||||..|.||.|.|||.||.:|||:.::..
 Frog    70 TALKGVVKIGAVNADQHQSLGGQYGVRGFPTIKVFGANKNKPDDYQGGRTADAIIDAALSSLRSF 134

  Fly   135 VQGVLGG-GGGSSSG----GSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAP 194
            |:..||| .|||.||    .||..|..|||:||:|.|||.||||||:|.|||:||||||||||.|
 Frog   135 VKDRLGGRSGGSDSGRQSYSSGGGSKKDVIDLTDDTFDKNVLNSDDVWFVEFYAPWCGHCKNLEP 199

  Fly   195 EWAKAAKELK----GKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTAS 255
            |||.||.|:|    |||||.|:|||..|..|:.|.:||:||||.|..|    .|..:||||||..
 Frog   200 EWAAAATEIKQQTNGKVKLAAVDATVSQVLASRYGIRGFPTIKIFQKG----EDPVDYDGGRTKP 260

  Fly   256 DIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLG 320
            |||:.|.|....|.|.||:.||:|....:..|:...||:|:|||||||..|..||.:||.:..:.
 Frog   261 DIVARAIDLFSENAPPPEIYEILNGDIVKKTCDEHQLCIVAVLPHILDTGASGRNSYLDVMMKMA 325

  Fly   321 EKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKDGINEFLRDIS 385
            :|:|:|.|||.|||.|.|:.||.||.:|||||||||.:|.:||||::||||||:.|||||||::|
 Frog   326 DKYKKKMWGWLWAEAGAQMDLETSLGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELS 390

  Fly   386 YGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDIDLSDIDLD---KDEL 433
            :|||.|:||.|...|.|.:|.|||||||:||.|:||||||::||   ||||
 Frog   391 FGRGSTSPVGGGAIPKINTVVPWDGKDGELPAEDDIDLSDVELDDFEKDEL 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 62/92 (67%)
PDI_a_P5 157..262 CDD:239299 67/108 (62%)
Thioredoxin_6 190..383 CDD:290560 107/196 (55%)
P5_C 271..400 CDD:239281 71/128 (55%)
pdia6NP_001007974.1 PDI_a_P5 26..128 CDD:239299 68/101 (67%)
PDI_a_P5 162..267 CDD:239299 67/108 (62%)
P5_C 276..405 CDD:239281 71/128 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 214 1.000 Domainoid score I2687
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4198
Inparanoid 1 1.050 527 1.000 Inparanoid score I1205
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D290413at33208
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 1 1.000 - - oto104388
Panther 1 1.100 - - LDO PTHR45815
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1799
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.