DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and l(2)01289

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001163065.1 Gene:l(2)01289 / 46017 FlyBaseID:FBgn0010482 Length:1786 Species:Drosophila melanogaster


Alignment Length:386 Identity:71/386 - (18%)
Similarity:140/386 - (36%) Gaps:103/386 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG--------------VVKV 78
            :||........::::.....|.||...|..|..:          |:|              :||:
  Fly  1425 IELITRQMLETMVEETQYLAVYFYKINCNICDQI----------LEGLELIDDECDVFGIHMVKI 1479

  Fly    79 GSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQ-RTAKAIAEAALAEVKKKVQGVLGGG 142
                  .|..|:.::.::.||.:..|  ...:|..:.|. :..:::.|..:.:..:::       
  Fly  1480 ------QDPQLAKRYSIKTFPALVYF--RNGNPLLFEGDLQNEQSVLEWLIDDDNREL------- 1529

  Fly   143 GGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKV 207
                        .|::.|:.|...|:|:..| .:.:|.|:...|..|:.:..|    .:|:.|:.
  Fly  1530 ------------ADEIEEVNERMLDRLMAES-TLLVVFFYDDDCAECEEILEE----LEEIDGEA 1577

  Fly   208 KLGALD--ATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASD-IVSWASDKHVANV 269
            .:..:|  ..|....|.:|.:...|::.:|     |......|||.....| :::|.:.:.|..:
  Fly  1578 DMFGIDFVKIASIQAAKKYEIVNIPSLVYF-----RKQVPVLYDGDLHQHDKVITWLTSQDVFEI 1637

  Fly   270 PAPELIEIINESTFETACEGKPLCVV-----------SVLPHILDCDAKCRNKFLD-TLRTLGEK 322
              ...||.:|....:...|......|           :.|..:.:.|::..|  || |...:.:.
  Fly  1638 --KNEIEEVNRKMLDKLLEENEFLAVFFYEHNQPDSTAALEKLENIDSETDN--LDITFVKMADS 1698

  Fly   323 FKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGS-FSKDGINEFLR 382
            ...|:||..                   ..|||  |.|::...|:.:|. .|:|.:.|:||
  Fly  1699 RYAKKWGVT-------------------KLPAM--VYFRRRFPSIYRGDLLSEDEVLEWLR 1738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 18/105 (17%)
PDI_a_P5 157..262 CDD:239299 24/107 (22%)
Thioredoxin_6 190..383 CDD:290560 42/209 (20%)
P5_C 271..400 CDD:239281 26/125 (21%)
l(2)01289NP_001163065.1 PDI_a_family 50..145 CDD:239259
PDI_a_family 384..479 CDD:239259
Thioredoxin_6 510..689 CDD:404691
ER_PDI_fam 700..>916 CDD:273457
PDI_a_family 1129..1226 CDD:239259
TRX_family 1433..>1502 CDD:239245 14/86 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.