DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and CG10029

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_649716.1 Gene:CG10029 / 40883 FlyBaseID:FBgn0037498 Length:410 Species:Drosophila melanogaster


Alignment Length:477 Identity:100/477 - (20%)
Similarity:174/477 - (36%) Gaps:125/477 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVGSVSAFYS------------PSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEY 65
            ||||:...||            .:..||.:|..|. :.::..:.:.::.||..||...|.|.|.:
  Fly     3 VVGSLHILYSLAILVSLHSLVAGNSSVVAVTHENL-QGIIDSNELVLLSFYTDWCRFSQILQPIF 66

  Fly    66 KKLAKAL------KGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI- 123
            ::.|..:      .|.|.:|.||.|.:..|:.||.:..:|||||.........:|.|||:.:|: 
  Fly    67 EEAAAKVIQKFPENGRVILGKVNCDTEDILADQFDILKYPTIKIVRNGLIGNQEYRGQRSVEALF 131

  Fly   124 --AEAALAEVKKKVQGV-----LGGGGGSSSGGSGSSSGDDVIELTEDNFDKL--VLNSDDIWLV 179
              .|..|::..|:...:     :..|.|...|...|....:.     ||:.::  :|.:|..:||
  Fly   132 QFVEKELSDPIKEFHNIDDLKNVDVGYGIVIGYFISKDHAEY-----DNYRRVASLLRNDCRFLV 191

  Fly   180 EFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASD 244
            .|               ....|:|:...|...:             .||.|:|      ....:.
  Fly   192 GF---------------GDLTKDLRPPGKNALI-------------FRGDPSI------PNHKNQ 222

  Fly   245 AQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETA----CEGKPLCVV----SVLPHI 301
            ..||.|..|:...:::..||        ..:.::.|.||:.|    .||.|..::    ..|..|
  Fly   223 YSEYLGNMTSFKELTFWIDK--------TCVPLVREVTFDNAEELSEEGLPFVLLFYNKDDLSPI 279

  Fly   302 LDCDAKCRNKFLDTLRTL-----GEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFK 361
            .:.....:::..:..|.:     ||.||...:         .|....|      ..|.:|:.:|.
  Fly   280 QEFKNAIQSQMENETRVIFLTAEGEVFKHPLF---------HLGKSPS------DLPVIAIDSFM 329

  Fly   362 KM-KFSVLKGSFSKDGINEFLRDISYG----RGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDI 421
            .| .|...:..:....:.:|:.|:..|    ..|.|  :.||:.....:||.:    .||...:.
  Fly   330 HMYLFPRFQDIYDPGALKKFIDDLFSGALHYNYHVA--QQAKEDLESIIDPTE----DLPVVHES 388

  Fly   422 DLSD----------IDLDKDEL 433
            ...|          ::..:|||
  Fly   389 KFKDLKPSKHRYTLVNRTRDEL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 29/98 (30%)
PDI_a_P5 157..262 CDD:239299 18/106 (17%)
Thioredoxin_6 190..383 CDD:290560 35/206 (17%)
P5_C 271..400 CDD:239281 28/146 (19%)
CG10029NP_649716.1 PDI_a_ERp44 27..134 CDD:239294 31/107 (29%)
PDI_b_ERp44 142..237 CDD:239368 23/133 (17%)
Thioredoxin_6 165..352 CDD:290560 43/248 (17%)
PDI_b'_ERp44 248..357 CDD:239370 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.