DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Pdi

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster


Alignment Length:266 Identity:83/266 - (31%)
Similarity:129/266 - (48%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 AKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAP 184
            |..:|.:|.||||.:                     :.|:..|.|||.:|:.:::.: ||||:||
  Fly    12 ASYVAASAEAEVKVE---------------------EGVLVATVDNFKQLIADNEFV-LVEFYAP 54

  Fly   185 WCGHCKNLAPEWAKAAKELKGK---VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQ 246
            ||||||.||||:||||::|..|   :||..:|||.....|.:|.||||||:|||.:||     ..
  Fly    55 WCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-----PV 114

  Fly   247 EYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNK 311
            ||.|||.|:||::|.:.|  ...||.:|..:.:...|   .:...:.::.....:...:||...|
  Fly   115 EYSGGRQAADIIAWVTKK--TGPPAKDLTSVADAEQF---LKDNEIAIIGFFKDLESEEAKTFTK 174

  Fly   312 FLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKM--KFSVLKGSFSK 374
            ..:.|         ..:.:..:.....:|..|:.:.|        ||.||..  |.||.:|..::
  Fly   175 VANAL---------DSFVFGVSSNADVIAKYEAKDNG--------VVLFKPFDDKKSVFEGELNE 222

  Fly   375 DGINEF 380
            :.:.:|
  Fly   223 ENLKKF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 55/107 (51%)
Thioredoxin_6 190..383 CDD:290560 59/196 (30%)
P5_C 271..400 CDD:239281 19/112 (17%)
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 76/230 (33%)
pdi_dom 33..133 CDD:273454 55/107 (51%)
PDI_b_family 137..231 CDD:239279 19/112 (17%)
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..469 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463711
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.