DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and p4hb

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001034820.1 Gene:p4hb / 395048 XenbaseID:XB-GENE-494070 Length:506 Species:Xenopus tropicalis


Alignment Length:486 Identity:109/486 - (22%)
Similarity:157/486 - (32%) Gaps:236/486 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADADST 88
            |:.|...||| |.||.....:|||||||||||::|.|||:|.|..||.   .:::|.|:|..:|.
 Frog    26 VLVLKKDNFD-EALKQYPFILVEFYAPWCGHCKALAPEYEKAAGVLKSEGLPIRLGKVDATEESD 89

  Fly    89 LSGQFGVRGFPTIKIF-GANKKSPTDYNGQRTAKAIA----------------EAALA------- 129
            |:.:|||||:||||.| ..:|.||.:|:..|.|..|.                ||.:|       
 Frog    90 LAQEFGVRGYPTIKFFKNGDKASPKEYSAGREAADIVNWLKKRTGPAASTLGDEAGVAALVDSSE 154

  Fly   130 -------------------EVKKKVQGVLGGGGGSSSGGSGSSSGDD------------------ 157
                               :..:.|..:..|...|.:..|....|.|                  
 Frog   155 VAVIGFFKDPASEPAKVFLQAAEAVDDIPFGITSSEAAFSKYELGKDGIVLFKKFDEGRNAYEGD 219

  Fly   158 -----------------VIELTED----------------------------------------- 164
                             |||.||.                                         
 Frog   220 ITKEEVLSFIKANRLPLVIEFTEQTAPMIFGGEIKTHILFFLPKSASDYKEKLEDFKKAAASFKG 284

  Fly   165 ----------------------------------------------------------------- 164
                                                                             
 Frog   285 KILFIFIDSDHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESADLSAEAIKEFCDSFLEG 349

  Fly   165 --------------------------NFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL 203
                                      ||:::|.|.:....|||:||||||||.|||.|.:..::.
 Frog   350 KVKPHLMSQDVSDDWDKNPVKILVGKNFEEVVFNEEKNVFVEFYAPWCGHCKQLAPIWDQLGEKY 414

  Fly   204 KG--KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAG-SKRASDAQEYDGGRTASDIVSW----- 260
            |.  .:.:..:|:||::.:|.:  :..:||:|||||| .|..:|   |:|.||......:     
 Frog   415 KDHENIIIAKMDSTANEIEAVK--IHSFPTLKFFPAGPGKNVAD---YNGERTLEGFSKFLESGG 474

  Fly   261 ---ASDKHVANVPAPELIEIINESTFETACE 288
               |:|:.:      |.:|..:||..|...|
 Frog   475 QDGAADEDL------EDLEDADESDLEEGDE 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 46/95 (48%)
PDI_a_P5 157..262 CDD:239299 44/282 (16%)
Thioredoxin_6 190..383 CDD:290560 32/110 (29%)
P5_C 271..400 CDD:239281 6/18 (33%)
p4hbNP_001034820.1 ER_PDI_fam 25..474 CDD:273457 101/453 (22%)
pdi_dom 29..133 CDD:273454 48/104 (46%)
PDI_b_family 137..232 CDD:239279 9/94 (10%)
PDI_b'_family 244..347 CDD:239280 0/102 (0%)
PDI_a_PDI_a'_C 368..470 CDD:239293 38/106 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.