DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and txndc5

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:252 Identity:81/252 - (32%)
Similarity:125/252 - (49%) Gaps:51/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK--GVVKVGSVNADADST 88
            |:.|||.:||...:.:.:..  ::|:|||||||::|.|.:::||...:  ..:|:..|:....:.
 Frog   163 GLYELTAANFKEHIAEGNHF--IKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNG 225

  Fly    89 LSGQFGVRGFPTIKIFGANKKSPTDYNGQR---TAKAIAEAAL--AEVKKKVQGVLGGGGGSSSG 148
            |.....|||:||:..| .|.:....|.|:|   :.|..||:.|  ||.||:              
 Frog   226 LCSDNQVRGYPTLLWF-RNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKE-------------- 275

  Fly   149 GSGSSSGDD---------------VIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAK 198
               ....:|               |:.|:|.|||:.|  :..:..::|:||||||||||.|.|..
 Frog   276 ---EEQKEDATPPQVEKPVAVESKVLSLSESNFDQTV--ATGVSFIKFYAPWCGHCKNLVPIWED 335

  Fly   199 -AAKELKG--KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGR 252
             :.||..|  .||:..:|.||.::....::||||||:..|.||.|    ..|::|.|
 Frog   336 LSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRAGEK----IGEHEGAR 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 31/97 (32%)
PDI_a_P5 157..262 CDD:239299 42/114 (37%)
Thioredoxin_6 190..383 CDD:290560 26/66 (39%)
P5_C 271..400 CDD:239281
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 32/101 (32%)
PDI_a_ERp46 296..397 CDD:239303 41/99 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.