DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and pdia2

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001307463.1 Gene:pdia2 / 394023 ZFINID:ZDB-GENE-040426-705 Length:555 Species:Danio rerio


Alignment Length:444 Identity:94/444 - (21%)
Similarity:141/444 - (31%) Gaps:223/444 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGV---VKVGSVNADADST 88
            |:.|...|||| .|.::...:|||||||||||:||.|.|.::|..||..   |::..|:|..:..
Zfish    58 VLILHSVNFDR-ALSENKYLLVEFYAPWCGHCRSLEPIYAEVAGQLKNASSEVRLAKVDAIEEKE 121

  Fly    89 LSGQFGVRGFPTIKIF-GANKKSPTDYNGQRTAKAI--------------------AEAALA--- 129
            |:.:|.|..|||:|.| ..|:::.|.:.|:||.|.|                    |||.|.   
Zfish   122 LASEFSVDSFPTLKFFKEGNRQNATTFFGKRTLKGIKRWLEKHTAPSATVLNDVKSAEALLEANE 186

  Fly   130 ------------------------------------------EVK-------------------- 132
                                                      |||                    
Zfish   187 VLVVGFFKDLEGEKAKTFYDVTLIAVDVNFGITSDPELFKKYEVKTDSLVLFKKFDERRADMPLS 251

  Fly   133 ----------------------------------------------------------------- 132
                                                                             
Zfish   252 DETKLDKGEMISFIHSNSMRLVVPFNEENAEQIFNSKVRKHLLLFLNTTVDSQNALVEEFREVAS 316

  Fly   133 ---------------KKVQGVLGGGGGSSS----------------GGSGSSSGDDVI------- 159
                           :||..||.....|..                ...||:...|.:       
Zfish   317 EFKEKVIFITVDVTAEKVNHVLKYFSISEDDVPTIRLINTEDVVTYAMDGSTINKDTLRTFCQGV 381

  Fly   160 ------------ELTED------------NFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAA 200
                        |:.||            ||:::..:......|||:|||||||:.|||.|.:..
Zfish   382 FDGTVKPYLKSQEIPEDWDKNPVKVLVGKNFNEVAFDESKNVFVEFYAPWCGHCQQLAPVWDELG 446

  Fly   201 KELKGK--VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGR 252
            ::.|.:  :.:..:|||  ::...:..::|:||||:||||:::  ...:|||.|
Zfish   447 EKYKDQENIIIAKMDAT--ENDVEDLTIQGFPTIKYFPAGTEK--KIVDYDGNR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 39/95 (41%)
PDI_a_P5 157..262 CDD:239299 37/129 (29%)
Thioredoxin_6 190..383 CDD:290560 21/65 (32%)
P5_C 271..400 CDD:239281
pdia2NP_001307463.1 ER_PDI_fam 56..512 CDD:273457 94/444 (21%)
PDI_a_family 65..161 CDD:239259 41/96 (43%)
PDI_b_family 169..268 CDD:239279 7/98 (7%)
PDI_b'_family 280..382 CDD:239280 8/101 (8%)
PDI_a_PDI_a'_C 403..505 CDD:239293 33/98 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.