DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and CG8993

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_647716.1 Gene:CG8993 / 38301 FlyBaseID:FBgn0035334 Length:142 Species:Drosophila melanogaster


Alignment Length:139 Identity:36/139 - (25%)
Similarity:62/139 - (44%) Gaps:11/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VKKKVQGVLGGGGGSSSGG------SGSSSGDDVIEL-TEDNFDKLVLNSDDIWLVEFFAPWCGH 188
            :::::..:||......:.|      |.|:...::.:: :.::|||.|.||....:|:|||.||..
  Fly     1 MQRQIINILGQTTRRLASGQQIRMLSVSAPRQEIFKVQSAEDFDKKVKNSQQPVIVDFFATWCNP 65

  Fly   189 CKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRT 253
            ||.|.|.......|..|.:||..:|...|...|.:|:|...|.:.....|    .:.|...|.:.
  Fly    66 CKLLTPRIESIVGEQAGSIKLAKVDIDEHSELALDYDVAAVPVLVVLQNG----KEVQRMVGLQD 126

  Fly   254 ASDIVSWAS 262
            ...|.:|.:
  Fly   127 EDKIRAWVA 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 31/105 (30%)
Thioredoxin_6 190..383 CDD:290560 18/73 (25%)
P5_C 271..400 CDD:239281
CG8993NP_647716.1 Thioredoxin_like 39..138 CDD:294274 31/101 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.