DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and CG5554

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster


Alignment Length:311 Identity:80/311 - (25%)
Similarity:123/311 - (39%) Gaps:96/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 SSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEW---AKAAKELKGK 206
            :::..||...|..:|||.|||: .|:|..:  |::|||||||..||||||.|   |:.||::  :
  Fly    25 TAAAQSGLQPGGKLIELDEDNW-HLMLQGE--WMIEFFAPWCPACKNLAPTWERFARVAKDV--Q 84

  Fly   207 VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIV------SWASDKH 265
            |::..:|.|...|.:..:.|...|||.....|..|     :|.|.|....::      .|.|.:.
  Fly    85 VQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFR-----QYRGARDGDALLYFVKKQQWQSIEP 144

  Fly   266 VANVPAPELIEIINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFK------ 324
            ::....|:...                  :|||.:..        |...||:...:.||      
  Fly   145 LSAWKKPDTTH------------------MSVLSYFF--------KLSHTLKHTQKLFKDFNGRL 183

  Fly   325 QKQWGW-AWAEGGQQLALEESLEVG-GFGYPAMAVVNF----KKMKFSVLKGSF--SKDGINEFL 381
            |:::|. .|  |...|....::.|| ..|...:.:|:|    ||.:    :.||  |:|.:.|.|
  Fly   184 QEEYGLPTW--GSYALFAIATIFVGAALGLLLVCLVDFVYPPKKSQ----RQSFSESQDNLTEGL 242

  Fly   382 RDISYGRGHTAPVRGAKKPAIVSVDPWDGKDGQLPTEEDIDLSDIDLDKDE 432
            .|                               |.|||..|..|.:.:.||
  Fly   243 ED-------------------------------LATEEIEDDGDAEENDDE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 40/113 (35%)
Thioredoxin_6 190..383 CDD:290560 51/215 (24%)
P5_C 271..400 CDD:239281 28/142 (20%)
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 39/109 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.