DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and ERp60

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:505 Identity:116/505 - (22%)
Similarity:167/505 - (33%) Gaps:236/505 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQLASILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEY 65
            |.:||.:|||.|:..|..|    ...|:||...:| ...||.....:|.|||||||||:.|.|||
  Fly     2 MWRLAGVLLLGFIAISSGA----EQDVLELGDDDF-ATTLKQHETTLVMFYAPWCGHCKRLKPEY 61

  Fly    66 KKLAKALKG---VVKVGSVN-ADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAE- 125
            .|.|:.:|.   .:|:..|: .:|......::.|.|:||:|||..::.| .||||.|.|..||: 
  Fly    62 AKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVS-QDYNGPREASGIAKY 125

  Fly   126 ------------AALAEVKK---------------------KV-------------------QGV 138
                        ..:||:||                     |:                   :.|
  Fly   126 MRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYRFGHSSEKEV 190

  Fly   139 LGGGG------------------GSSSGGSGSSS------------------------------- 154
            |...|                  .||....|||.                               
  Fly   191 LDKQGETDKIVLIRAPHLSNKFESSSIKFEGSSESDLSTFVKENFHGLVGHRTQDSVKDFQNPLI 255

  Fly   155 -------------------------------------------------------GDDVIELTED 164
                                                                   ||..:.|..|
  Fly   256 TAYYSVDYQKNPKGTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFVGDKPVVLARD 320

  Fly   165 ----------------------------------------------------NFDKLVLNSDDIW 177
                                                                |||.||:|:....
  Fly   321 EKNLKYALKDEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAPVKVAVAKNFDDLVINNGKDT 385

  Fly   178 LVEFFAPWCGHCKNLAPEWAKAAKELKGK-VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKR 241
            |:||:||||||||.|:|.:.:.|::|:.: |.:..:||||: ....|:||||:||:.:.|..:| 
  Fly   386 LIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATAN-DVPPEFNVRGFPTLFWLPKDAK- 448

  Fly   242 ASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKP 291
             :....|:|||...|.:     |::|.....||      ..|:.:  |||
  Fly   449 -NKPVSYNGGREVDDFL-----KYIAKEATTEL------KGFDRS--GKP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 38/96 (40%)
PDI_a_P5 157..262 CDD:239299 42/157 (27%)
Thioredoxin_6 190..383 CDD:290560 32/103 (31%)
P5_C 271..400 CDD:239281 6/21 (29%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 103/471 (22%)
PDI_a_PDIR 23..126 CDD:239295 42/104 (40%)
PDI_b_ERp57 133..235 CDD:239367 13/101 (13%)
PDI_b'_ERp72_ERp57 239..345 CDD:239371 4/105 (4%)
PDI_a_PDI_a'_C 365..467 CDD:239293 41/109 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.