DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and CG9302

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster


Alignment Length:392 Identity:104/392 - (26%)
Similarity:155/392 - (39%) Gaps:95/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG----VVKVGSVNADADSTLSGQF 93
            ::|.:.:.||....:|.||.||||.|:.:.|||.|.:..||.    ::...:|....::.:...|
  Fly   152 ASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAAMNVERQENAPIRKMF 216

  Fly    94 GVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDV 158
            .:.||||: |:..|.|....|.|:...:|:....|....|...       ........:.:..::
  Fly   217 NITGFPTL-IYFENGKLRFTYEGENNKEALVSFMLNPNAKPTP-------KPKEPEWSADTNSEI 273

  Fly   159 IELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKV---KLGALDATAHQSK 220
            :.||...|:. .|..:...||.|:||||||||.:.||:.|||.|:|.|.   .|.|||||...|.
  Fly   274 VHLTSQGFEP-ALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSI 337

  Fly   221 AAEYNVRGYPTIKFFPAGSKRASDAQEYD-GGRTASDIVSWASD-KHVANVPAPEL--------- 274
            |.:|.|:||||:|||..|      ..::: ..|.||.||.:..| |.....|.||.         
  Fly   338 AEKYKVKGYPTVKFFSNG------VFKFEVNVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDSK 396

  Fly   275 -IEIINESTFETACEGK---------PLC------------VVSVL---PHI----LDCDAKCRN 310
             :..:::..|.:..:.|         |.|            ..:.|   |.|    :||      
  Fly   397 EVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQDDPRIAFVAIDC------ 455

  Fly   311 KFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSKD 375
               ..|..|..|:..:                        |||.:...::.|.|.....|..|||
  Fly   456 ---TKLAALCAKYNVR------------------------GYPTILYFSYLKTKLDYNGGRTSKD 493

  Fly   376 GI 377
            .|
  Fly   494 FI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 28/89 (31%)
PDI_a_P5 157..262 CDD:239299 46/108 (43%)
Thioredoxin_6 190..383 CDD:290560 59/231 (26%)
P5_C 271..400 CDD:239281 24/145 (17%)
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 29/97 (30%)
ER_PDI_fam 166..500 CDD:273457 101/378 (27%)
PDI_a_PDIR 272..373 CDD:239295 46/107 (43%)
PDI_a_PDIR 397..498 CDD:239295 22/132 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.