DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and CG18132

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster


Alignment Length:102 Identity:26/102 - (25%)
Similarity:44/102 - (43%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK--VKLGALDATAHQSK 220
            :::|..|||  .....|..:.|:|:.|.|..|.:....|...||..|.|  :....|:....::.
  Fly    52 ILKLRVDNF--FETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTI 114

  Fly   221 AAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDI 257
            ..:|.:|..|.:.:...|    .:.|:|||..|:..|
  Fly   115 CNDYELRYEPNLIWLENG----EEVQQYDGDLTSPGI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 26/102 (25%)
Thioredoxin_6 190..383 CDD:290560 16/70 (23%)
P5_C 271..400 CDD:239281
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 26/102 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.