DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and prtp

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:412 Identity:106/412 - (25%)
Similarity:170/412 - (41%) Gaps:100/412 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL---KGVVKVGSVNADADSTL 89
            |||.|..||..:...:..  |:|:|||||||:.:.|.:::||:.:   ...|.:..|:......|
  Fly    40 VELDPETFDTAIAGGNVF--VKFFAPWCGHCKRIQPLWEQLAEIMNVDNPKVIIAKVDCTKHQGL 102

  Fly    90 SGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI-----------AEAALAEVKKKVQGVLGGGG 143
            .....|.|:||:::|...::....:.|.|...||           |||.|.|||::....|..| 
  Fly   103 CATHQVTGYPTLRLFKLGEEESVKFKGTRDLPAITDFINKELSAPAEADLGEVKREQVENLNIG- 166

  Fly   144 GSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKEL--KGK 206
                         .|::||||.|.|.|...:.  .|:||||||.||:.|||.|...||||  :..
  Fly   167 -------------KVVDLTEDTFAKHVSTGNH--FVKFFAPWCSHCQRLAPTWEDLAKELIKEPT 216

  Fly   207 VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSW----------- 260
            |.:..:|.|..:|...::.|:||||:.:...|.|    .::|.|.|..|.:.::           
  Fly   217 VTISKIDCTQFRSICQDFEVKGYPTLLWIEDGKK----IEKYSGARDLSTLKTYVEKMVGVPLEK 277

  Fly   261 ---------------ASDKHVANVPAPELIEIINESTFETA-CEG-------KPLCVVSVLPHIL 302
                           |.::..|....|:  ::..|..|:.| .||       .|.|         
  Fly   278 TAGEAGDEKVVIEEVAGEEDAAKKLTPQ--QLTGEDEFDQAIAEGVAFIKFYAPWC--------- 331

  Fly   303 DCDAKCRNKFLDTLRTLGEKFKQKQWGW------AWAEGGQQLALEESLEVGGFGYPAMAVVNFK 361
               ..|: |...|...|..:..|.|...      ..|...:|:.:::.:|    |||.:.:  :|
  Fly   332 ---GHCQ-KLQPTWEQLATETHQAQSSVKIAKVDCTAPENKQVCIDQQVE----GYPTLFL--YK 386

  Fly   362 K-MKFSVLKGSFSKDGINEFLR 382
            . .:.:..:||.|...:..:|:
  Fly   387 NGQRQNEYEGSRSLPELQAYLK 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 27/93 (29%)
PDI_a_P5 157..262 CDD:239299 40/132 (30%)
Thioredoxin_6 190..383 CDD:290560 50/236 (21%)
P5_C 271..400 CDD:239281 25/127 (20%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303 30/101 (30%)
ER_PDI_fam 39..409 CDD:273457 106/412 (26%)
PDI_a_ERp46 167..267 CDD:239303 40/105 (38%)
PDI_a_ERp46 303..407 CDD:239303 24/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.