DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Erp44

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001008318.1 Gene:Erp44 / 298066 RGDID:1309176 Length:406 Species:Rattus norvegicus


Alignment Length:493 Identity:103/493 - (20%)
Similarity:169/493 - (34%) Gaps:166/493 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SILLLAFVVGSVSAFYSP-SDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLA 69
            |:|||      |::.::| :..:..|...|.| |:|.:..:.:|.|||.||...|.|.|.:::.:
  Rat    15 SLLLL------VTSIFAPITAEIASLDSENID-EILNNADVALVNFYADWCRFSQMLHPIFEEAS 72

  Fly    70 KAL------KGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAAL 128
            ..:      |..|....|:.|..|.::.::.:..:||:|:|........:|.|||:.||:|:...
  Rat    73 DVIKEEYPDKNQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIR 137

  Fly   129 AEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIEL--------------TEDN---FDKL--VLNSD 174
            .:....|..:              .|.|:|..|              ..||   |:::  :|:.|
  Rat   138 QQKSNPVHEI--------------QSLDEVTNLDRSKRNIIGYFEQKDSDNYRVFERVASILHDD 188

  Fly   175 DIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGS 239
            ..:|..|                            |.|      ||...|:   ...:.:.|.| 
  Rat   189 CAFLSAF----------------------------GDL------SKPERYS---GDNLIYKPPG- 215

  Fly   240 KRASDAQEYDGGRTASDIV-SWASDKHVANVPAPELIEIINESTFETACEGKPLCVV-------- 295
             |:.....|.|..|..|:. :|..||.|     |.:.||..|:..|...||.|..::        
  Rat   216 -RSVPDMVYLGSMTNFDVTFNWIQDKCV-----PLVREITFENGEELTEEGLPFLILFHMKEDTE 274

  Fly   296 -------SVLPHIL-----------DCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALE 342
                   .|...::           ||| |.|:..|...:|..:                     
  Rat   275 SLEIFQNEVARQLISEKGTINFLHADCD-KFRHPLLHIQKTPAD--------------------- 317

  Fly   343 ESLEVGGFGYPAMAVVNFKKM-KFSVLKGSFSKDGINEFLRDISYGRGH-----------TAPVR 395
                     .|.:|:.:|:.| .|...|.......:.:|:.|:..|:.|           |||  
  Rat   318 ---------CPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAP-- 371

  Fly   396 GAKKPAIVSVDPWDGKDGQLPTEEDIDLSDIDLDKDEL 433
            |.:...:.|..|........|:|....|.   .|:|||
  Rat   372 GEQDQDVASSPPESSFQKLAPSEYRYTLL---RDRDEL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 26/98 (27%)
PDI_a_P5 157..262 CDD:239299 22/124 (18%)
Thioredoxin_6 190..383 CDD:290560 39/220 (18%)
P5_C 271..400 CDD:239281 30/166 (18%)
Erp44NP_001008318.1 PDI_a_ERp44 29..136 CDD:239294 30/107 (28%)
PDI_b_ERp44 144..234 CDD:239368 24/142 (17%)
Thioredoxin_6 167..350 CDD:290560 46/257 (18%)
PDI_b'_ERp44 245..355 CDD:239370 23/140 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.