DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Erp27

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001100095.1 Gene:Erp27 / 297698 RGDID:1565381 Length:272 Species:Rattus norvegicus


Alignment Length:145 Identity:31/145 - (21%)
Similarity:58/145 - (40%) Gaps:37/145 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SDGVVELTPSNFDREVLKDDAIWVVEFYAPWCG----------HCQSLV----PE-------YKK 67
            ::.:.:|..:...|.:..::..||.| |:|..|          |...::    ||       |:|
  Rat   121 AEDIDDLDAAKLSRFIHLNNLHWVTE-YSPMIGAGLFNTMVQTHLLLIMNKASPEYEESLRSYQK 184

  Fly    68 LAKALKGVVKVGSVNADADSTLSGQ----FGVR--GFPTIKIFGANKKSPTDYNGQRTAKAIAEA 126
            .||..:|  ::..|..|:....:|:    |.::  ..|.:.|:    :|..|   :..|..|.|.
  Rat   185 AAKLFQG--QILFVLVDSGKRENGKVIAYFRLKESQLPALAIY----ESVDD---KWDALTITEV 240

  Fly   127 ALAEVKKKVQGVLGG 141
            .:.:|:....|.|.|
  Rat   241 TVEKVQSFCNGFLKG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 24/119 (20%)
PDI_a_P5 157..262 CDD:239299
Thioredoxin_6 190..383 CDD:290560
P5_C 271..400 CDD:239281
Erp27NP_001100095.1 PDI_b_family 43..139 CDD:239279 2/17 (12%)
Thioredoxin_6 64..250 CDD:290560 28/138 (20%)
PDI_b'_family 156..253 CDD:239280 21/105 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.