DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and SPAC17H9.14c

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_593584.1 Gene:SPAC17H9.14c / 2542270 PomBaseID:SPAC17H9.14c Length:359 Species:Schizosaccharomyces pombe


Alignment Length:346 Identity:103/346 - (29%)
Similarity:159/346 - (45%) Gaps:61/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFVVGSVSAFYSPSDGVVELTPSN-FDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKAL 72
            ||:||:.::.|....| |||||...| .:..:.......::||||.|||||:||.|.|::|....
pombe     5 LLSFVIFALFALVFAS-GVVELQSLNELENTIRASKKGALIEFYATWCGHCKSLAPVYEELGALF 68

  Fly    73 K--GVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEV---K 132
            :  ..|.:|.::||..|.::.::.:.||||:..|..:...|..|:..|...::.:....:.   |
pombe    69 EDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKK 133

  Fly   133 KKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWA 197
            :|:  ||               ..:|:||...||||:|::.....||||:|.|||:||.|||.:.
pombe   134 RKI--VL---------------PSNVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYE 181

  Fly   198 KAAKELKGK--VKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQE-YDGGRTASDIVS 259
            ...|..|.:  |::..::|.........:.|..:|||||||...|   |..| |:|.|:..    
pombe   182 TLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDK---DKPELYEGDRSLE---- 239

  Fly   260 WASDKHVANVPAPELIEIIN-ESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKF 323
                         .|||.|| :|..:.:.:|..|.....:|...:..|    :|||......|..
pombe   240 -------------SLIEYINKKSGTQRSPDGTLLSTAGRIPTFDEFAA----EFLDMSNAAKEVV 287

  Fly   324 KQKQWGWAWAEGGQQLALEES 344
            .:|.         :|||||:|
pombe   288 LEKV---------KQLALEDS 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 32/95 (34%)
PDI_a_P5 157..262 CDD:239299 39/107 (36%)
Thioredoxin_6 190..383 CDD:290560 43/159 (27%)
P5_C 271..400 CDD:239281 21/75 (28%)
SPAC17H9.14cNP_593584.1 PDI_a_ERp38 21..125 CDD:239296 33/103 (32%)
Thioredoxin_6 55..247 CDD:290560 65/228 (29%)
PDI_a_ERp38 141..245 CDD:239296 42/123 (34%)
ERp29 265..354 CDD:285048 13/48 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100473
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1799
TreeFam 1 0.960 - -
65.670

Return to query results.
Submit another query.