DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Y73B6BL.12

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:90 Identity:37/90 - (41%)
Similarity:48/90 - (53%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSKA 221
            :|:.|..| |...||:|.:.|:|:|||||||||...||.:.:.||||.|||....:|........
 Worm    19 EVVSLGND-FHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELAGKVNFAKIDCDQWPGVC 82

  Fly   222 AEYNVRGYPTIKFF--PAGSKRASD 244
            ....||.||||:.:  ..|..|..|
 Worm    83 QGAQVRAYPTIRLYTGKTGWSRQGD 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 37/90 (41%)
Thioredoxin_6 190..383 CDD:290560 19/57 (33%)
P5_C 271..400 CDD:239281
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 37/90 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.