DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and erp-44.3

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_501357.3 Gene:erp-44.3 / 185676 WormBaseID:WBGene00018358 Length:434 Species:Caenorhabditis elegans


Alignment Length:435 Identity:86/435 - (19%)
Similarity:142/435 - (32%) Gaps:140/435 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKL-- 68
            |.|||.|   .::...|.:..:..:|.:|.| |::::..:..|.|.|.||...:.|:..:.:.  
 Worm    29 STLLLGF---GITFLISVNCNLESITSTNHD-EIIQNSRLTFVAFTASWCPFSRKLMSSFSQAAA 89

  Fly    69 ---AKALKGVVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAE 130
               ||........|:|:..|:..|..::.:..|||:|:|...... |:|.|.|..|.:.|     
 Worm    90 DYQAKYPDRKTVWGNVDCMAEDYLMNKYSITKFPTMKVFFYGYMM-TEYRGSRQVKGLIE----- 148

  Fly   131 VKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPE 195
                                       .||..|:....:.||.     .|....|..:   :.|:
 Worm   149 ---------------------------YIEKMENTSSLVNLNE-----AESLTQWQNY---VIPQ 178

  Fly   196 WAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSK-------------------- 240
                    ||.:                        |.:||.||.                    
 Worm   179 --------KGTL------------------------ILWFPRGSPPFELILKAIALIHSQLVVVV 211

  Fly   241 -------RASDAQ---EYDG-------GRTAS--DIVSWASDKHVANVPAPELIEIINESTFETA 286
                   :..|.|   ..||       |..::  :||.|...|...         ::.|.|||..
 Worm   212 PISENLLKHEDHQLWFSLDGEHVERFEGSVSNFKEIVEWIKKKSAG---------MVRELTFENM 267

  Fly   287 CE----GKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEV 347
            .|    ||||.   :|....| |.:...:|:.|:|...::....:.....|:|....|:......
 Worm   268 EEMVEDGKPLL---ILLRKKD-DIETEKQFVTTIRRELDQDTLLKLAPVMADGKVLTAVLRHFNK 328

  Fly   348 GGFGYPAMAVVNFKKMKFSVLKGS--FSKDGINEFLRDISYGRGH 390
            |....|.:.:..|.....|..||:  |::..|.:|:.|:.....|
 Worm   329 GLDDLPFLLIDQFTHSFPSPWKGNEIFAEGNIKQFVADLFNDNHH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 24/97 (25%)
PDI_a_P5 157..262 CDD:239299 23/143 (16%)
Thioredoxin_6 190..383 CDD:290560 44/237 (19%)
P5_C 271..400 CDD:239281 29/126 (23%)
erp-44.3NP_501357.3 Thioredoxin_like 45..150 CDD:381987 27/138 (20%)
Thioredoxin_like 259..369 CDD:381987 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.