Sequence 1: | NP_001285979.1 | Gene: | CaBP1 / 34976 | FlyBaseID: | FBgn0025678 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_035162.1 | Gene: | P4hb / 18453 | MGIID: | 97464 | Length: | 509 | Species: | Mus musculus |
Alignment Length: | 444 | Identity: | 99/444 - (22%) |
---|---|---|---|
Similarity: | 140/444 - (31%) | Gaps: | 220/444 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 DGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK---GVVKVGSVNADAD 86
Fly 87 STLSGQFGVRGFPTIKIF-GANKKSPTDYNGQR---------------TAKAIAEAALAE--VKK 133
Fly 134 KVQGVLG------------------------GGGGSSSG--------------------GSGSSS 154
Fly 155 GDD----------------VIELTED--------------------------------------- 164
Fly 165 ----------------------------------------------------------------- 164
Fly 165 ----------------------------NFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAK 201
Fly 202 ELKG--KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRT 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CaBP1 | NP_001285979.1 | PDI_a_P5 | 26..119 | CDD:239299 | 44/111 (40%) |
PDI_a_P5 | 157..262 | CDD:239299 | 41/247 (17%) | ||
Thioredoxin_6 | 190..383 | CDD:290560 | 24/66 (36%) | ||
P5_C | 271..400 | CDD:239281 | |||
P4hb | NP_035162.1 | ER_PDI_fam | 26..476 | CDD:273457 | 99/444 (22%) |
Thioredoxin_like | 31..135 | CDD:294274 | 43/104 (41%) | ||
PDI_b_family | 139..234 | CDD:239279 | 13/94 (14%) | ||
PDI_b'_family | 246..349 | CDD:239280 | 0/102 (0%) | ||
PDI_a_PDI_a'_C | 370..472 | CDD:239293 | 36/99 (36%) | ||
Prevents secretion from ER | 506..509 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |