DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and trx-1

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001021885.1 Gene:trx-1 / 181863 WormBaseID:WBGene00015062 Length:115 Species:Caenorhabditis elegans


Alignment Length:81 Identity:27/81 - (33%)
Similarity:47/81 - (58%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VELTPSNFDREVLK-DDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKGVVKVGSVNADADSTLSG 91
            |:...|:|::.:.: .:.|.:::|||.|||.|:::.|.||:||...||:: ...|:.|....|..
 Worm    11 VKYFQSDFEQLIRQHPEKIIILDFYATWCGPCKAIAPLYKELATTHKGII-FCKVDVDEAEDLCS 74

  Fly    92 QFGVRGFPTIKIFGAN 107
            ::.|:..||. ||..|
 Worm    75 KYDVKMMPTF-IFTKN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 27/81 (33%)
PDI_a_P5 157..262 CDD:239299
Thioredoxin_6 190..383 CDD:290560
P5_C 271..400 CDD:239281
trx-1NP_001021885.1 Thioredoxin 16..111 CDD:278513 26/76 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.