DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and dpy-11

DIOPT Version :10

Sequence 1:NP_609792.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001370731.1 Gene:dpy-11 / 179040 WormBaseID:WBGene00001073 Length:246 Species:Caenorhabditis elegans


Alignment Length:144 Identity:44/144 - (30%)
Similarity:68/144 - (47%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 KVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEW-- 196
            ::..|||......|||...||  .::.|.|:|:..|:...   |::||.||||..||:|...|  
 Worm     4 RLLAVLGLFAVGVSGGPTRSS--KLVFLNEENWTDLMKGE---WMIEFHAPWCPACKDLQKAWNA 63

  Fly   197 -AKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSW 260
             |..:.:|  .:|:|.:|.|.:...:..:.|...|||.....|..|     :|.|.|..:|.:|:
 Worm    64 FADWSDDL--GIKVGEVDVTVNPGLSGRFLVTALPTIYHVKDGVFR-----QYSGARDKNDFISF 121

  Fly   261 ASDKHVANV-PAPE 273
            ..||....: |.|:
 Worm   122 VEDKKYRVIDPVPD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_609792.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 32/107 (30%)
P5_C 271..400 CDD:239281 1/3 (33%)
dpy-11NP_001370731.1 PDI_a_TMX 24..124 CDD:239292 33/111 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.