DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and dnj-27

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001040704.1 Gene:dnj-27 / 173065 WormBaseID:WBGene00001045 Length:788 Species:Caenorhabditis elegans


Alignment Length:251 Identity:78/251 - (31%)
Similarity:119/251 - (47%) Gaps:45/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAFVVGSVSAFYSPSDGVVELTPSNFDREVL--KDDAIWVVEFYAPWCGHCQSLVPEYKKLAKA 71
            :|.|:..|:    :||  |:|::|..|:..|:  ||:..|:|:|:|||||.||.|.||.:|.|:.
 Worm   539 ILEFLDNSL----NPS--VMEMSPEQFEELVMNRKDEETWLVDFFAPWCGPCQQLAPELQKAARQ 597

  Fly    72 LKGV---VKVGSVNADADSTLSGQFGVRGFPTIKIFGANK-----KSP-TDYNGQ--RTAKAIAE 125
            :...   ..|.|::....:.......:..:||::::.|.|     :|| .||...  |.:.:|  
 Worm   598 IAAFDENAHVASIDCQKYAQFCTNTQINSYPTVRMYPAKKTKQPRRSPFYDYPNHMWRNSDSI-- 660

  Fly   126 AALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCK 190
                  ::.|...|               ..:|:.|..| |...||:|.:.|:|:|||||||||.
 Worm   661 ------QRWVYNFL---------------PTEVVSLGND-FHTTVLDSSEPWIVDFFAPWCGHCI 703

  Fly   191 NLAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFF--PAGSKRASD 244
            ..||.:.:.||||.|||....:|............||.||||:.:  ..|..|..|
 Worm   704 QFAPIYDQIAKELAGKVNFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGD 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 32/105 (30%)
PDI_a_P5 157..262 CDD:239299 37/90 (41%)
Thioredoxin_6 190..383 CDD:290560 19/57 (33%)
P5_C 271..400 CDD:239281
dnj-27NP_001040704.1 DnaJ 18..>150 CDD:223560
DnaJ 20..82 CDD:278647
PDI_a_ERdj5_N 116..214 CDD:239301
Thioredoxin_like 222..>312 CDD:294274
ER_PDI_fam 438..750 CDD:273457 75/240 (31%)
PDI_a_ERdj5_C 438..543 CDD:239302 1/3 (33%)
PDI_a_ERdj5_C 549..664 CDD:239302 36/124 (29%)
PDI_a_ERdj5_C 670..773 CDD:239302 37/91 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2193
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.