Sequence 1: | NP_001285979.1 | Gene: | CaBP1 / 34976 | FlyBaseID: | FBgn0025678 | Length: | 433 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492913.1 | Gene: | png-1 / 173028 | WormBaseID: | WBGene00010160 | Length: | 606 | Species: | Caenorhabditis elegans |
Alignment Length: | 227 | Identity: | 42/227 - (18%) |
---|---|---|---|
Similarity: | 78/227 - (34%) | Gaps: | 76/227 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSK 220
Fly 221 AAEYNVRGYPTIKFF----------------------------PAGSKRASDAQEYDGGRTASDI 257
Fly 258 VSWASDKHVANVP---APELIEIINESTFETACEGK-----PLCVVSVLPHIL------------ 302
Fly 303 -----DCDAKCRNKFLDTLRTLGEKFKQKQWG 329 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CaBP1 | NP_001285979.1 | PDI_a_P5 | 26..119 | CDD:239299 | |
PDI_a_P5 | 157..262 | CDD:239299 | 25/132 (19%) | ||
Thioredoxin_6 | 190..383 | CDD:290560 | 32/193 (17%) | ||
P5_C | 271..400 | CDD:239281 | 14/81 (17%) | ||
png-1 | NP_492913.1 | TRX_family | 20..103 | CDD:239245 | 17/92 (18%) |
Transglut_core | 204..296 | CDD:280085 | 3/13 (23%) | ||
YebA | <235..312 | CDD:224224 | |||
PAW | 407..604 | CDD:299187 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |