DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and png-1

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_492913.1 Gene:png-1 / 173028 WormBaseID:WBGene00010160 Length:606 Species:Caenorhabditis elegans


Alignment Length:227 Identity:42/227 - (18%)
Similarity:78/227 - (34%) Gaps:76/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGKVKLGALDATAHQSK 220
            ::::|.::.|  :|:       :::|||.|||.|:.::|.:.:.:.|. |......::....:..
 Worm    13 NNILERSDAN--RLI-------IIDFFANWCGPCRMISPIFEQFSAEY-GNATFLKVNCDVARDI 67

  Fly   221 AAEYNVRGYPTIKFF----------------------------PAGSKRASDAQEYDGGRTASDI 257
            ...||:...||..|.                            ||....|||:::    |.....
 Worm    68 VQRYNISAMPTFIFLKNRQQVDMVRGANQQAIAEKIRQHYSPTPANPNAASDSEK----RFLEQF 128

  Fly   258 VSWASDKHVANVP---APELIEIINESTFETACEGK-----PLCVVSVLPHIL------------ 302
            |.      .:|||   ..|:.:.:..|.......|:     |....::|..:|            
 Worm   129 VK------CSNVPRSYQDEVFKALARSVMPEELVGRAMTEGPRDEKAILKDLLHWFKTQFFTWFD 187

  Fly   303 -----DCDAKCRNKFLDTLRTLGEKFKQKQWG 329
                 .|..||..   |.|:....:.:||:.|
 Worm   188 RPTCPKCTLKCST---DGLQGTPTREEQKEGG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 25/132 (19%)
Thioredoxin_6 190..383 CDD:290560 32/193 (17%)
P5_C 271..400 CDD:239281 14/81 (17%)
png-1NP_492913.1 TRX_family 20..103 CDD:239245 17/92 (18%)
Transglut_core 204..296 CDD:280085 3/13 (23%)
YebA <235..312 CDD:224224
PAW 407..604 CDD:299187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.