DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and pdi-3

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_491995.1 Gene:pdi-3 / 172433 WormBaseID:WBGene00003964 Length:488 Species:Caenorhabditis elegans


Alignment Length:473 Identity:109/473 - (23%)
Similarity:161/473 - (34%) Gaps:220/473 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLLAFVVGSVSAFYSPSDGVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKA 71
            |.:.|.:|.|..||.|....|:|.|..||| ::::...|.:|:|||||||||:.:.|||::.|..
 Worm     2 IWVQAALVASFLAFASAGGAVLEYTDGNFD-DLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPK 65

  Fly    72 LKG---VVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI---------- 123
            |..   .|.:..|:...:.|:..:|||:||||:||| .|.....||:|.|.|..|          
 Worm    66 LASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIF-RNGVPAQDYDGPRDADGIVKFMRGQSGP 129

  Fly   124 ---------------------------AEAALAE------------------------------- 130
                                       :|:.|.:                               
 Worm   130 SSKELKTVAEFEKFTGGDENVVIGFFESESKLKDSYLKVADTERDRFSFAHTSNKDIIKKAGYSD 194

  Fly   131 -----VKKK-------------------------VQGVLGGGG---------------------- 143
                 |.||                         |...:|..|                      
 Worm   195 DVVVFVPKKLHNKFDTNEFKYDGNYDTDKIKNFLVHETVGFAGIRTQGNLFQFEQKPIVIVYYNV 259

  Fly   144 -------GSS--------------------------------SGGSGSSSGDD---VIELTED-- 164
                   ||:                                :.|.|.....|   |..||.:  
 Worm   260 DYVKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGK 324

  Fly   165 ----------------------------------------------NFDKLVLNSDDIWLVEFFA 183
                                                          ||.:|::::|...|:||:|
 Worm   325 YPMDQEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDEQGDVKVAVGKNFKELIMDADKDVLIEFYA 389

  Fly   184 PWCGHCKNLAPEWAKAAKEL-KGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQE 247
            |||||||:|||::.:.|::| |..|.:..:||||:..... :.|||:||:.:.|..:|  |:...
 Worm   390 PWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPM-FEVRGFPTLFWLPKNAK--SNPIP 451

  Fly   248 YDGGRTASDIVSWASDKH 265
            |:|||...|.||:.| ||
 Worm   452 YNGGREVKDFVSFIS-KH 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 39/95 (41%)
PDI_a_P5 157..262 CDD:239299 45/156 (29%)
Thioredoxin_6 190..383 CDD:290560 30/77 (39%)
P5_C 271..400 CDD:239281
pdi-3NP_491995.1 ER_PDI_fam 21..477 CDD:273457 102/454 (22%)
Thioredoxin_like 26..127 CDD:294274 40/102 (39%)
PDI_b_ERp57 130..232 CDD:239367 6/101 (6%)
PDI_b'_ERp72_ERp57 236..344 CDD:239371 9/107 (8%)
PDI_a_PDI_a'_C 364..465 CDD:239293 41/103 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.