DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and D2092.4

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_491903.2 Gene:D2092.4 / 172378 WormBaseID:WBGene00017065 Length:363 Species:Caenorhabditis elegans


Alignment Length:313 Identity:59/313 - (18%)
Similarity:120/313 - (38%) Gaps:72/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SVSAFYSPSDGVVELTPSNFDREVLKDDA----IWVVEFYAPWCGHCQSLVPEYKKLAKALK--G 74
            ::|:.:...|..::....:...|:|:|.:    |::.:...| |..|...:.|.:::...::  |
 Worm    65 ALSSKHKDDDNSIDDVDEDRIDEILRDASKNLVIFLYDGKVP-CPTCTEALSEVEEIDDDIEATG 128

  Fly    75 VVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQ--------RTAKAIAEAALAEV 131
            .|:|...|   |.:::.:.|:..||::..:  .:|:|..|:|.        |..:|..|.|    
 Worm   129 YVQVVKTN---DRSVARELGINVFPSLVYY--RRKNPILYDGDFKDSETLLRWLRAHEEVA---- 184

  Fly   132 KKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFD-KLVLNSDD----IWLVEFFAPWCGHCKN 191
                                      ..:||:|.|: :...:|.|    .|.|.|:....|:...
 Worm   185 --------------------------TWDLTDDTFESRTDSHSPDEGSIDWFVMFYDADEGNSNA 223

  Fly   192 LAPEWAKAAKELKGKVKLGALDATAHQSKAAEYNV--RGYPTIKFFPAGSKRASDAQEY-DGGRT 253
            ..|.|...|.:|:|.|.:|.::.:.:......:::  |..|....|..|.     ...| :..:.
 Worm   224 FVPLWETVAHKLRGLVNVGKIEISVNDDVTERFHIEERDCPVFLLFHRGK-----MYRYKESAKD 283

  Fly   254 ASDIVSWASDKHVA----NVPAP-----ELIEIINESTFETACEGKPLCVVSV 297
            |..:.::|..|:..    .||.|     ::.|...|...:...:.:.|.|:.|
 Worm   284 ARSLTNFALHKYKEQRGHRVPEPPTAIEQVYEFAKEKIMDIMDDNQTLSVLGV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 20/106 (19%)
PDI_a_P5 157..262 CDD:239299 23/112 (21%)
Thioredoxin_6 190..383 CDD:290560 23/120 (19%)
P5_C 271..400 CDD:239281 6/32 (19%)
D2092.4NP_491903.2 Thioredoxin_like 92..177 CDD:381987 18/90 (20%)
PTZ00443 188..>316 CDD:185622 28/132 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.