DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and ZK973.11

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:287 Identity:74/287 - (25%)
Similarity:113/287 - (39%) Gaps:87/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKGK---VKLGALDATAHQS 219
            |::|::...|   :..:.:|.|||:||||.|||.|.|.|.:....|...   :::|.||.|...:
 Worm    30 VLDLSDKFLD---VKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRFPA 91

  Fly   220 KAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFE 284
            .|.:.:::|||||.||     |.....:|.|||....:||:|  |..|   || :||:|||:..|
 Worm    92 VANKLSIQGYPTILFF-----RNGHVIDYRGGREKEALVSFA--KRCA---AP-IIEVINENQIE 145

  Fly   285 ---TACEGKPLCV--------------------------VSVLPHILDCDAKCRNK--------- 311
               .:...:|..|                          .||.|.  :.||..|.:         
 Worm   146 KVKLSARSQPSYVFFGTSSGPLFDAFNEAASSKFSVARFYSVAPP--ENDASFRQRVAVFKDNFE 208

  Fly   312 --FLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEVGGFGYPAMAVVNFKKMKFSVLKGSFSK 374
              |...:..|.|...:::|     .|..|.......|:|..|...:.||:.:..||:        
 Worm   209 IEFNGDIEKLTEWVTRERW-----PGFLQATSSNLAEIGASGKLVVLVVSSESHKFN-------- 260

  Fly   375 DGINEFLRDISYGRGHTAPVRGAKKPA 401
                           :|:|:|...|.|
 Worm   261 ---------------NTSPIREFHKTA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 37/106 (35%)
Thioredoxin_6 190..383 CDD:290560 56/235 (24%)
P5_C 271..400 CDD:239281 32/168 (19%)
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 74/287 (26%)
PDI_a_TMX3 29..132 CDD:239298 39/111 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.