DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and ERP27

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:326 Identity:63/326 - (19%)
Similarity:103/326 - (31%) Gaps:127/326 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWL----- 178
            |.:..||.| |||:|            ||.|.|::                   .:..||     
Human    16 TCELAAEVA-AEVEK------------SSDGPGAA-------------------QEPTWLTDVPA 48

  Fly   179 -VEFFAPW----CGHCKNL----APEWAKAAKELKGKVKLGALDATAHQSKAAEYNVRGYPTIKF 234
             :||.|..    .|..::|    .|......::..| |..|   .:........||:.| .||..
Human    49 AMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPG-VSFG---ISTDSEVLTHYNITG-NTICL 108

  Fly   235 FPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINESTFETACEGKPLCVV---- 295
            |     |..|.::.:           ..|:.:.::.|.:|...|..::.....|..|:.|:    
Human   109 F-----RLVDNEQLN-----------LEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFN 157

  Fly   296 SVLP-HILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQL--ALEESLEVGGFGYPAMAV 357
            ||:. |:|....|...::.:.:....:..|..|        |:.|  .::..::..|      .|
Human   158 SVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQ--------GKILFILVDSGMKENG------KV 208

  Fly   358 VNFKKMKFSVLKGSFSKDGINEFLRDISYGRGHTAPVRGAKKPAIVSV----DPWDGKDGQLPTE 418
            ::|.|:|.|.|                               ||:...    |.||    .|||.
Human   209 ISFFKLKESQL-------------------------------PALAIYQTLDDEWD----TLPTA 238

  Fly   419 E 419
            |
Human   239 E 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 63/326 (19%)
PDI_a_P5 157..262 CDD:239299 19/118 (16%)
Thioredoxin_6 190..383 CDD:290560 36/203 (18%)
P5_C 271..400 CDD:239281 22/135 (16%)
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:372755 45/246 (18%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 1/2 (50%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.