DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CaBP1 and Txndc5

DIOPT Version :9

Sequence 1:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster
Sequence 2:NP_001258259.1 Gene:Txndc5 / 100362805 RGDID:2323973 Length:417 Species:Rattus norvegicus


Alignment Length:250 Identity:85/250 - (34%)
Similarity:133/250 - (53%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALK--GVVKVGSVNADADST 88
            |:.||:.:||:..|.:.:..  ::|:|||||||::|.|.:::||..|:  ..||:|.|:......
  Rat   176 GLYELSANNFELHVSQGNHF--IKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYA 238

  Fly    89 LSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAI----------AEAALAEVKKKVQGVLGGGG 143
            :..:..|||:||:..|...|| ...|.|:|..:::          :|||...|:.....||   .
  Rat   239 VCSEHQVRGYPTLLWFRDGKK-VDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVL---A 299

  Fly   144 GSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAK-AAKELKG-- 205
            ....|..|:     |:.|||.:|:..:  :..|..|:|:||||||||||||.|.: :.||..|  
  Rat   300 AEPPGDKGT-----VLALTEKSFEDTI--AQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLA 357

  Fly   206 KVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSW 260
            .|.:..:|.||.:...::|:||||||:..|..|.|    ..|::|||....:.|:
  Rat   358 DVTIAEVDCTAERGVCSKYSVRGYPTLLLFRGGEK----VGEHNGGRDLDSLHSF 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299 33/94 (35%)
PDI_a_P5 157..262 CDD:239299 43/106 (41%)
Thioredoxin_6 190..383 CDD:290560 28/73 (38%)
P5_C 271..400 CDD:239281
Txndc5NP_001258259.1 PDI_a_ERp46 47..150 CDD:239303
ER_PDI_fam 52..417 CDD:273457 85/249 (34%)
PDI_a_ERp46 176..276 CDD:239303 34/102 (33%)
PDI_a_ERp46 308..409 CDD:239303 43/111 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.