DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chif and DBF4

DIOPT Version :9

Sequence 1:NP_523583.2 Gene:chif / 34974 FlyBaseID:FBgn0000307 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_010337.3 Gene:DBF4 / 851623 SGDID:S000002459 Length:704 Species:Saccharomyces cerevisiae


Alignment Length:322 Identity:71/322 - (22%)
Similarity:112/322 - (34%) Gaps:121/322 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DICDHQLAKRIESDIKALGGHLEFFLSDDI-THFVTDKPEVIGGTSGTPGTPSTPGTPTSHYQQN 114
            |:|..:...|...:|||.|.|    .|:|: |.|        |...|          ||.     
Yeast   479 DLCTLKTKSRQAFEIKASGAH----QSNDVATSF--------GNGLG----------PTR----- 516

  Fly   115 DGSARKPNQRQSRADAILSRV---RRSTVGVVNSGNSTPTTSLKRSYTIWQTDYAQRFIKRIQTE 176
             .|....|.:.      |||:   |:..|...|..|...|.::..:                   
Yeast   517 -ASVMSKNMKS------LSRLMVDRKLGVKQTNGNNKNYTATIATT------------------- 555

  Fly   177 LKQYLEGKKEGGGGSTSASPHHIQ---LKKQYVKIESVKRNYRPYYHLIKQPDDWPKIDLSSEDG 238
                .|..||        :.|.:.   |||.....:...::...:....::|.::||:       
Yeast   556 ----AETSKE--------NRHRLDFNALKKDEAPSKETGKDSAVHLETNRKPQNFPKV------- 601

  Fly   239 AFRLLTKSKTKD-KEH-----SMTRKPLGSRTSQK-------DKQAAGEAKPLQHPSLQELKKQS 290
                .|||.:.| |.|     :.|..|..|:.|..       :.|.|..|:|        :||::
Yeast   602 ----ATKSVSADSKVHNDIKITTTESPTASKKSTSTNVTLHFNAQTAQTAQP--------VKKET 654

  Fly   291 AIPNSPRSNCREPIDSSEKQGGVCEICKLEYDILNIHLQSKDHELFAKNSDNFLALDTLIQS 352
            .                 |..|.||.|:::|:.|..|:.|:.|..||:|..||.|:|:||::
Yeast   655 V-----------------KNSGYCENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIEN 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chifNP_523583.2 DBF4 <40..350 CDD:227399 69/318 (22%)
ZnF_DBF 307..355 CDD:128854 19/46 (41%)
DBF4NP_010337.3 DBF4 1..704 CDD:227399 71/322 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5067
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7555
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003541
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15375
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4510
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.