DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment chif and DBF4

DIOPT Version :9

Sequence 1:NP_523583.2 Gene:chif / 34974 FlyBaseID:FBgn0000307 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_006707.1 Gene:DBF4 / 10926 HGNCID:17364 Length:674 Species:Homo sapiens


Alignment Length:708 Identity:155/708 - (21%)
Similarity:255/708 - (36%) Gaps:242/708 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PKVKVIKSK--------RPLCHFKFYLDICDHQLAKRIESDIKALGGHLEFFLSDDITHFVTDKP 88
            |.:|.:|:.        :||....||||:....::::::.|||.|||.:|.|||.||::.:::|.
Human    27 PSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKK 91

  Fly    89 E-----VIGGTSGTPGTPST-PGTPTSHYQQNDGSARKPNQRQSRADAILSRVRRSTVGVVNSGN 147
            |     .:|..|..|...|. ....||.:..:|||:.|     |.....|||.:......:...:
Human    92 EAKFAQTLGRISPVPSPESAYTAETTSPHPSHDGSSFK-----SPDTVCLSRGKLLVEKAIKDHD 151

  Fly   148 STPTTSLKRSYTIW-----QTDYAQRFIKRIQTELKQYL----------EGKKEGGGGSTSASPH 197
            ..|:.|:..:...|     ..|..:.:|::.:.||  ||          .||:.|.|...:.:. 
Human   152 FIPSNSILSNALSWGVKILHIDDIRYYIEQKKKEL--YLLKKSSTSVRDGGKRVGSGAQKTRTG- 213

  Fly   198 HIQLKKQYVKIESVKRNYRPYYHLIKQPDDWPKIDLSSED--GAFRLLTKSKTKDKEHSMTRKPL 260
              :|||.:||:|.:.:.|||:|   .|..:.|.|:.|.:.  ..|.:       ||..||.::..
Human   214 --RLKKPFVKVEDMSQLYRPFY---LQLTNMPFINYSIQKPCSPFDV-------DKPSSMQKQTQ 266

  Fly   261 GSRTSQKD-KQAAGEAKPLQHPSLQELKKQSAIPNSPRSNCREPIDSSEKQGGVCEICKLEYDIL 324
            .....|.| .:..|.:..||   |:|.||:                      |.||.|..:|:.|
Human   267 VKLRIQTDGDKYGGTSIQLQ---LKEKKKK----------------------GYCECCLQKYEDL 306

  Fly   325 NIHLQSKDHELFAKNSDNFLALDTLIQSSADVNRFLEEEPVESELDMDVDESLSNEELQSPRQRP 389
            ..||.|:.|..||: |:.:..:|.::                |:|..|..|          .::.
Human   307 ETHLLSEQHRNFAQ-SNQYQVVDDIV----------------SKLVFDFVE----------YEKD 344

  Fly   390 SPALREKSKRITKGKHSSEKFQGVAVASPQTPFPGAKKVQGNSPGSLSELQR---QEHPTTAAAT 451
            :|    |.|||   |:|......|:.:.       .||.:......|..:.:   ||..||.   
Human   345 TP----KKKRI---KYSVGSLSPVSASV-------LKKTEQKEKVELQHISQKDCQEDDTTV--- 392

  Fly   452 PTTNSGRRKTQNSGLSPPKRAMLPPSSIYKVVETREE----CATPPRGRGRPPNQVDSPSLIVKF 512
                    |.||              .:||..:..|:    .:.|          :..||     
Human   393 --------KEQN--------------FLYKETQETEKKLLFISEP----------IPHPS----- 420

  Fly   513 QKIRQTELQRLNGE---------------AENFMFPRTAVPTTRSSSELPTDVDRQTTSD----- 557
                 .||:.||.:               .:||    |.:|..::..|...|:...|.|:     
Human   421 -----NELRGLNEKMSNKCSMLSTAEDDIRQNF----TQLPLHKNKQECILDISEHTLSENDLEE 476

  Fly   558 ---------VRGRYSISSASLDTSTSEAETKESSGLPTSIRKRAQAVGRRRKVGGAAAQDVFQRQ 613
                     ::....:|..|.|.|.|:.:.|..:.|                   ..|:|:.::.
Human   477 LRVDHYKCNIQASVHVSDFSTDNSGSQPKQKSDTVL-------------------FPAKDLKEKD 522

  Fly   614 L------STGSSSSNSNQQR--------FPSAPIQPEE------GPQPQPKPQLKIKI 651
            |      .:|..:.||:|:.        |.:.|.:|.|      ...|..|...|:||
Human   523 LHSIFTHDSGLITINSSQEHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKI 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
chifNP_523583.2 DBF4 <40..350 CDD:227399 89/341 (26%)
ZnF_DBF 307..355 CDD:128854 14/47 (30%)
DBF4NP_006707.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 3/12 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 100..131 10/35 (29%)
zf-DBF 294..336 CDD:322049 16/58 (28%)
Integrase domain-binding motif 1 (IBM1). /evidence=ECO:0000269|PubMed:29997176 614..638
Integrase domain-binding motif 2 (IBM2). /evidence=ECO:0000269|PubMed:29997176 655..674
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142166
Domainoid 1 1.000 70 1.000 Domainoid score I9548
eggNOG 1 0.900 - - E1_COG5067
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003541
OrthoInspector 1 1.000 - - otm40552
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15375
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4510
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.