DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and BCL3

DIOPT Version :9

Sequence 1:NP_001260496.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:XP_011525500.2 Gene:BCL3 / 602 HGNCID:998 Length:696 Species:Homo sapiens


Alignment Length:248 Identity:82/248 - (33%)
Similarity:125/248 - (50%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PSSINIMNAWEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHPCL-LNIQNDVAQTPLHLAA 274
            |.|.:|..|    .:.::|||||||:|.:.|::..|..|:.:...... |:|.|::.|||||||.
Human   342 PLSADIAMA----TRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV 402

  Fly   275 LTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSN 339
            :|..|:::|:|:.|||.|...||||.||.||:|......|:|||.:                   
Human   403 ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLD------------------- 448

  Fly   340 DKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAI 404
                   |.|....|||.|||||...:|:|......:.:::|:..||||:|.:.||||:||..|:
Human   449 -------SAAPGTLDLEARNYDGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAV 506

  Fly   405 EGCNEDLANFLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAET 457
            |..:..:...||.....:|.:  .|:|.:|...|.......:...|.:.||::
Human   507 ENNSLSMVQLLLQHGANVNAQ--MYSGSSALHSASGRGLLPLVRTLVRSGADS 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 24/61 (39%)
ANK repeat 229..263 CDD:293786 13/34 (38%)
Ank_4 230..286 CDD:290365 23/56 (41%)
ANK 260..416 CDD:238125 56/155 (36%)
ANK repeat 265..296 CDD:293786 15/30 (50%)
Ank_2 270..391 CDD:289560 42/120 (35%)
ANK repeat 298..324 CDD:293786 11/25 (44%)
ANK repeat 361..393 CDD:293786 10/31 (32%)
Ank_5 381..438 CDD:290568 20/56 (36%)
ANK repeat 395..425 CDD:293786 10/29 (34%)
BCL3XP_011525500.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341288at2759
OrthoFinder 1 1.000 - - FOG0002150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.