DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and Ankrd22

DIOPT Version :10

Sequence 1:NP_476942.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_077166.4 Gene:Ankrd22 / 52024 MGIID:1277101 Length:191 Species:Mus musculus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:64/174 - (36%) Gaps:62/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 QQNDDGDTPLHLACISGSVDVVAALIRMAPHPCLLNIQNDVAQTPLHLA---------------- 273
            |.:.:|||||..||..|.:.:|:.|:|....   :|::|...:|.||.|                
Mouse    35 QDSFNGDTPLICACRRGHLRIVSFLLRRNAD---VNLKNLKERTCLHYAVKKRFTFFDYLLIILL 96

  Fly   274 ------------ALTAQ-PNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGAT 325
                        :.|.| ..::|:||.||.|....|..|.||||.:|....:..:..|.      
Mouse    97 MPVLLIGYFLMVSKTKQNETLVRMLLNAGVEVNATDCDGYTALHYACQMKNQTLIPLLL------ 155

  Fly   326 EIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLA 369
               |||                     ||..|:|..||..:.:|
Mouse   156 ---EAH---------------------ADPMIKNKHGESSLDIA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_476942.1 ANKYR <225..464 CDD:440430 44/174 (25%)
ANK repeat 229..263 CDD:293786 12/33 (36%)
ANK repeat 265..296 CDD:293786 12/59 (20%)
ANK repeat 298..324 CDD:293786 7/25 (28%)
ANK repeat 361..393 CDD:293786 3/9 (33%)
ANK repeat 395..425 CDD:293786
Ankrd22NP_077166.4 ANKYR <8..190 CDD:440430 44/174 (25%)
ANK repeat 39..70 CDD:293786 12/33 (36%)
ANK 1 39..68 11/31 (35%)
ANK repeat 72..132 CDD:293786 12/59 (20%)
ANK 2 72..100 4/27 (15%)
ANK 3 101..130 8/28 (29%)
ANK repeat 134..165 CDD:293786 13/60 (22%)
ANK 4 134..163 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.