| Sequence 1: | NP_001260496.1 | Gene: | cact / 34969 | FlyBaseID: | FBgn0000250 | Length: | 500 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_065390.1 | Gene: | NFKBIA / 4792 | HGNCID: | 7797 | Length: | 317 | Species: | Homo sapiens |
| Alignment Length: | 277 | Identity: | 98/277 - (35%) |
|---|---|---|---|
| Similarity: | 136/277 - (49%) | Gaps: | 38/277 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 220 WEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHP-CLLNIQNDVAQTPLHLAALTAQPNIMR 283
Fly 284 ILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSY 348
Fly 349 ACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLAN 413
Fly 414 FLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAET--VTPPDSDYDSSDIED---- 472
Fly 473 -LDDTKMYDR--FGDPR 486 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cact | NP_001260496.1 | ANK | <225..286 | CDD:238125 | 26/61 (43%) |
| ANK repeat | 229..263 | CDD:293786 | 12/34 (35%) | ||
| Ank_4 | 230..286 | CDD:290365 | 24/56 (43%) | ||
| ANK | 260..416 | CDD:238125 | 61/155 (39%) | ||
| ANK repeat | 265..296 | CDD:293786 | 16/30 (53%) | ||
| Ank_2 | 270..391 | CDD:289560 | 44/120 (37%) | ||
| ANK repeat | 298..324 | CDD:293786 | 11/25 (44%) | ||
| ANK repeat | 361..393 | CDD:293786 | 15/31 (48%) | ||
| Ank_5 | 381..438 | CDD:290568 | 26/56 (46%) | ||
| ANK repeat | 395..425 | CDD:293786 | 12/29 (41%) | ||
| NFKBIA | NP_065390.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
| Ank_2 | <27..>151 | CDD:330894 | 40/86 (47%) | ||
| Destruction motif | 30..36 | ||||
| Nuclear export signal | 45..54 | ||||
| ANK repeat | 73..108 | CDD:293786 | 12/34 (35%) | ||
| ANK 1 | 73..103 | 10/29 (34%) | |||
| ANK | 105..237 | CDD:238125 | 61/155 (39%) | ||
| ANK repeat | 110..141 | CDD:293786 | 16/30 (53%) | ||
| ANK 2 | 110..139 | 16/28 (57%) | |||
| Nuclear import signal | 110..120 | 7/9 (78%) | |||
| ANK repeat | 143..180 | CDD:293786 | 13/60 (22%) | ||
| ANK 3 | 143..172 | 11/28 (39%) | |||
| ANK repeat | 182..213 | CDD:293786 | 15/30 (50%) | ||
| ANK 4 | 182..211 | 13/28 (46%) | |||
| ANK repeat | 216..246 | CDD:293786 | 12/31 (39%) | ||
| ANK 5 | 216..245 | 12/30 (40%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165156345 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E33208_3BM8A | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 1 | 1.000 | - | - | H7863 | |
| Inparanoid | 1 | 1.050 | 136 | 1.000 | Inparanoid score | I4568 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1341288at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002150 | |
| OrthoInspector | 1 | 1.000 | - | - | oto90651 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_108699 | |
| Panther | 1 | 1.100 | - | - | LDO | PTHR46680 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 11 | 10.800 | |||||