DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and iPLA2-VIA

DIOPT Version :9

Sequence 1:NP_001260496.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_729565.2 Gene:iPLA2-VIA / 39160 FlyBaseID:FBgn0036053 Length:887 Species:Drosophila melanogaster


Alignment Length:422 Identity:86/422 - (20%)
Similarity:148/422 - (35%) Gaps:144/422 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EFAVPNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQKEQPVVLDSGIIDEEEDQEEQ 128
            |..:...||||...|       ||  :.....:|:.:::.:|..:..||.:  .|:.|..:....
  Fly    66 EIILQRPTSDSNTTS-------FS--LYRSPVQQEAEERFNAFLQRLPVFV--SIVKEYYNVNGL 119

  Fly   129 EKEEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQSSTA 193
            :|      ...|.||:           |.||: |||::....::.:......|.     |..:.|
  Fly   120 QK------ACDALADN-----------PSWTL-SHLIAYFNLVDYISNPKMLQC-----VDQADA 161

  Fly   194 ST------------------------------ANANPSGSGATSSA--------PPSSINIMNAW 220
            :|                              .|:|.....|.|:.        ..|::|:.:. 
  Fly   162 ATLMSPFQLAIKQGHMEMVKALLPLSKLEHLDINSNSVFHYAASTTKEIINLIIDKSTVNLNHL- 225

  Fly   221 EQFYQQNDDGDTPLHLACISGSVDVVAALI------------------RMAPHPCLLNIQNDVAQ 267
                  |.||.||||:||::...:.|.||:                  ..||......::.:|::
  Fly   226 ------NSDGYTPLHVACLADKPENVKALLLAGANVNLNAKDIRKVYKTSAPTTVSSFLRTNVSK 284

  Fly   268 ----------TPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKF 322
                      ||||..   :....:..|::.|.:....:..|.||||:.......:||..|.   
  Fly   285 LYTQDMKYGGTPLHWC---SSRETLHALIMEGCDVNATNFDGRTALHVMVARNRFECVVTLL--- 343

  Fly   323 GATEIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGAD 387
                   ||                    .|::::.:.||...:|:|.|...:.|::.||..|.|
  Fly   344 -------AH--------------------DAEIDVLDKDGNAALHIAIEKKLVPIVQCLVVFGCD 381

  Fly   388 INAREGKSGRTPLHIA---IEGCNEDLANFLL 416
            ||.: .|.|:||.|:.   ..|..:|...::|
  Fly   382 INLK-NKDGKTPRHMVGNDASGNKDDEILYIL 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 19/88 (22%)
ANK repeat 229..263 CDD:293786 13/51 (25%)
Ank_4 230..286 CDD:290365 17/83 (20%)
ANK 260..416 CDD:238125 37/168 (22%)
ANK repeat 265..296 CDD:293786 7/40 (18%)
Ank_2 270..391 CDD:289560 27/120 (23%)
ANK repeat 298..324 CDD:293786 8/25 (32%)
ANK repeat 361..393 CDD:293786 12/31 (39%)
Ank_5 381..438 CDD:290568 14/39 (36%)
ANK repeat 395..425 CDD:293786 7/25 (28%)
iPLA2-VIANP_729565.2 ANK repeat 166..226 CDD:293786 6/66 (9%)
Ank_2 168..258 CDD:289560 18/96 (19%)
ANK 191..343 CDD:238125 34/161 (21%)
ANK repeat 228..261 CDD:293786 11/32 (34%)
ANK 291..412 CDD:238125 36/154 (23%)
ANK repeat 292..320 CDD:293786 6/30 (20%)
Ank_2 297..386 CDD:289560 27/122 (22%)
ANK repeat 322..353 CDD:293786 11/60 (18%)
ANK repeat 355..386 CDD:293786 12/31 (39%)
ANK repeat 388..417 CDD:293786 7/25 (28%)
Pat_PNPLA9 563..876 CDD:132851
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463173
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.