DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and Ankrd22

DIOPT Version :10

Sequence 1:NP_476942.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001178567.1 Gene:Ankrd22 / 294093 RGDID:1307862 Length:191 Species:Rattus norvegicus


Alignment Length:174 Identity:43/174 - (24%)
Similarity:62/174 - (35%) Gaps:62/174 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 QQNDDGDTPLHLACISGSVDVVAALIRMAPHPCLLNIQNDVAQTPLHLA---------------- 273
            |...:|||||..||..|.:.:|:.|:|....   :|::|...:|.||.|                
  Rat    35 QDGFNGDTPLICACRRGHLRIVSFLLRRNAD---VNLKNLKERTCLHYAVKKRFTFFDYLLIILL 96

  Fly   274 ------------ALTAQPN-IMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGAT 325
                        :.|.|.. ::|:||.||.|....|.:|.||||.:|                  
  Rat    97 MPVLLIGYFLMVSKTKQNEALVRMLLNAGVEVNATDCYGYTALHYAC------------------ 143

  Fly   326 EIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLA 369
                      ...|...:..|..|  .||..|:|..||..:.:|
  Rat   144 ----------QMKNQTLIPLLLAA--RADPTIKNKHGESSLDIA 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_476942.1 ANKYR <225..464 CDD:440430 43/174 (25%)
ANK repeat 229..263 CDD:293786 12/33 (36%)
ANK repeat 265..296 CDD:293786 12/59 (20%)
ANK repeat 298..324 CDD:293786 6/25 (24%)
ANK repeat 361..393 CDD:293786 3/9 (33%)
ANK repeat 395..425 CDD:293786
Ankrd22NP_001178567.1 ANKYR <8..189 CDD:440430 43/174 (25%)
ANK repeat 39..70 CDD:293786 12/33 (36%)
ANK repeat 72..132 CDD:293786 12/59 (20%)
ANK repeat 134..165 CDD:293786 12/60 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.