DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and Nfkbie

DIOPT Version :9

Sequence 1:NP_001260496.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_001291885.1 Gene:Nfkbie / 18037 MGIID:1194908 Length:371 Species:Mus musculus


Alignment Length:414 Identity:114/414 - (27%)
Similarity:169/414 - (40%) Gaps:85/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PNETSDSGFISGPQSSQIFSEEIVPDSEEQDKDQQESAPQ--KEQPVVLDSGIIDEEEDQEEQEK 130
            |:|..||...||.:|.:.......|.:.......|...||  :..|               |..|
Mouse     8 PDEADDSQCDSGIESLRSLRSLPEPTAAPGSGSSQSGCPQPWRHAP---------------ETHK 57

  Fly   131 EEEHQDTTTATADSMRLKHSADTGIPQWTVESHLVSRGEQLNNLGQSSSTQITGRSKVQSSTAST 195
            |.|.:|.....|||.....|.....|       |:.|.|.                         
Mouse    58 EPEKEDADGERADSTYASSSLTESFP-------LLERPEA------------------------- 90

  Fly   196 ANANPSGSGATSSAPPSSINIMNAWEQFYQQNDDGDTPLHLACISGSVDVVAALIRMAPHPCLLN 260
              .:||.....|..||:.:......|.....::||||.||||.|..:..|:...:...|.. :|:
Mouse    91 --KDPSPPAPGSPLPPAGVLSPQQLEALTYISEDGDTLLHLAVIHEAPSVLFCCLAFLPQE-VLD 152

  Fly   261 IQNDVAQTPLHLAALTAQPNIMRILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGAT 325
            |||::.||.||||....||:::|.|:|.||...::|:||:||||::|......|...|.|     
Mouse   153 IQNNLYQTALHLAVHLDQPDVVRALVLKGASRILQDQHGDTALHVACRRQNLACACCLLE----- 212

  Fly   326 EIHEAHRQYGHRSNDKAVSSLSYACLPADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINA 390
            |..|..||..|               |.||:::|:.|..|:|:|....:..::.:|:.:||||:.
Mouse   213 EQPEPGRQLSH---------------PLDLQLKNWQGLACLHIATLQRNQPLIELLLQNGADIDV 262

  Fly   391 REGKSGRTPLHIAIEGCNEDLANFLLD-----ECEKLNLETATYAGLTAYQFACIMNKSRMQNIL 450
            :||.||:|.||:|:|.....|..|||.     :...||       |.|....|.....:.:.:.|
Mouse   263 QEGTSGKTALHLAVETQERSLVQFLLQAGARVDARMLN-------GCTPLHLAAGRGLNSISSTL 320

  Fly   451 EKRGAETVTPPDSDYDSSDI-EDL 473
            .:.||:::.....|....|: |||
Mouse   321 CEAGADSLLLNVEDETPQDLAEDL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_001260496.1 ANK <225..286 CDD:238125 24/60 (40%)
ANK repeat 229..263 CDD:293786 13/33 (39%)
Ank_4 230..286 CDD:290365 23/55 (42%)
ANK 260..416 CDD:238125 56/155 (36%)
ANK repeat 265..296 CDD:293786 13/30 (43%)
Ank_2 270..391 CDD:289560 40/120 (33%)
ANK repeat 298..324 CDD:293786 10/25 (40%)
ANK repeat 361..393 CDD:293786 9/31 (29%)
Ank_5 381..438 CDD:290568 22/61 (36%)
ANK repeat 395..425 CDD:293786 13/34 (38%)
NfkbieNP_001291885.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..108 30/148 (20%)
Ank_2 <116..188 CDD:289560 28/72 (39%)
ANK 118..254 CDD:238125 52/156 (33%)
ANK repeat 122..155 CDD:293786 13/33 (39%)
ANK 1 122..155 13/33 (39%)
ANK 152..320 CDD:238125 63/194 (32%)
ANK 2 157..186 13/28 (46%)
ANK repeat 159..188 CDD:293786 13/28 (46%)
Ank_2 162..263 CDD:289560 40/120 (33%)
ANK repeat 190..231 CDD:293786 18/60 (30%)
ANK 3 190..219 12/33 (36%)
ANK 4 233..262 9/28 (32%)
ANK repeat 234..264 CDD:293786 9/29 (31%)
Ank_2 238..326 CDD:289560 27/94 (29%)
ANK repeat 267..298 CDD:293786 11/30 (37%)
ANK 5 267..296 11/28 (39%)
ANK 295..>370 CDD:238125 13/57 (23%)
ANK repeat 300..334 CDD:293786 7/40 (18%)
ANK 6 300..329 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1341288at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43754
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.