DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cact and Nfkbia

DIOPT Version :10

Sequence 1:NP_476942.1 Gene:cact / 34969 FlyBaseID:FBgn0000250 Length:500 Species:Drosophila melanogaster
Sequence 2:NP_035037.2 Gene:Nfkbia / 18035 MGIID:104741 Length:314 Species:Mus musculus


Alignment Length:278 Identity:97/278 - (34%)
Similarity:141/278 - (50%) Gaps:43/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 WEQFYQQNDDGDTPLHLACISGSVDVVAALI-RMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMR 283
            |:|  |..:|||:.||||.|.....:...:| ::......||.||::.|||||||.:|.||.|..
Mouse    66 WKQ--QLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVITNQPGIAE 128

  Fly   284 ILLLAGAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSY 348
            .||.||.:|.:||..|||.|||:|   |:.|:                         .:|:.|:.
Mouse   129 ALLKAGCDPELRDFRGNTPLHLAC---EQGCL-------------------------ASVAVLTQ 165

  Fly   349 ACLP----ADLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNE 409
            .|.|    :.|:..||:|..|:|||:..|::.|:..||:.|||:||:|..:|||.||:|::..|.
Mouse   166 TCTPQHLHSVLQATNYNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNP 230

  Fly   410 DLANFLLDECEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAET--VTPPDSDYDSSDIED 472
            ||.:.|| :| ..::...||.|.:.||.......:|:|..|.:...|.  :.|...|.:|.|.|.
Mouse   231 DLVSLLL-KC-GADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTES 293

  Fly   473 --LDDTKMYDR--FGDPR 486
              .:|...||.  ||..|
Mouse   294 EFTEDELPYDDCVFGGQR 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cactNP_476942.1 ANKYR <225..464 CDD:440430 85/245 (35%)
ANK repeat 229..263 CDD:293786 11/34 (32%)
ANK repeat 265..296 CDD:293786 16/30 (53%)
ANK repeat 298..324 CDD:293786 9/25 (36%)
ANK repeat 361..393 CDD:293786 14/31 (45%)
ANK repeat 395..425 CDD:293786 12/29 (41%)
NfkbiaNP_035037.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Destruction motif. /evidence=ECO:0000250|UniProtKB:P25963 30..36
ANKYR 34..>256 CDD:440430 81/221 (37%)
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:P25963 45..54
ANK repeat 73..108 CDD:293786 11/34 (32%)
ANK 1 73..103 9/29 (31%)
ANK repeat 110..141 CDD:293786 16/30 (53%)
ANK 2 110..139 16/28 (57%)
Nuclear import signal. /evidence=ECO:0000250|UniProtKB:P25963 110..120 7/9 (78%)
ANK repeat 143..180 CDD:293786 14/64 (22%)
ANK 3 143..172 13/56 (23%)
ANK repeat 182..213 CDD:293786 14/30 (47%)
ANK 4 182..211 12/28 (43%)
ANK repeat 216..246 CDD:293786 12/31 (39%)
ANK 5 216..245 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.