| Sequence 1: | NP_001260496.1 | Gene: | cact / 34969 | FlyBaseID: | FBgn0000250 | Length: | 500 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_291079.2 | Gene: | Bcl3 / 12051 | MGIID: | 88140 | Length: | 448 | Species: | Mus musculus |
| Alignment Length: | 234 | Identity: | 75/234 - (32%) |
|---|---|---|---|
| Similarity: | 121/234 - (51%) | Gaps: | 33/234 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 227 NDDGDTPLHLACISGSVDVV---AALIRMAPHPCLLNIQNDVAQTPLHLAALTAQPNIMRILLLA 288
Fly 289 GAEPTVRDRHGNTALHLSCIAGEKQCVRALTEKFGATEIHEAHRQYGHRSNDKAVSSLSYACLPA 353
Fly 354 DLEIRNYDGERCVHLAAEAGHIDILRILVSHGADINAREGKSGRTPLHIAIEGCNEDLANFLLDE 418
Fly 419 CEKLNLETATYAGLTAYQFACIMNKSRMQNILEKRGAET 457 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| cact | NP_001260496.1 | ANK | <225..286 | CDD:238125 | 21/61 (34%) |
| ANK repeat | 229..263 | CDD:293786 | 10/36 (28%) | ||
| Ank_4 | 230..286 | CDD:290365 | 20/58 (34%) | ||
| ANK | 260..416 | CDD:238125 | 55/155 (35%) | ||
| ANK repeat | 265..296 | CDD:293786 | 15/30 (50%) | ||
| Ank_2 | 270..391 | CDD:289560 | 42/120 (35%) | ||
| ANK repeat | 298..324 | CDD:293786 | 10/25 (40%) | ||
| ANK repeat | 361..393 | CDD:293786 | 10/31 (32%) | ||
| Ank_5 | 381..438 | CDD:290568 | 20/56 (36%) | ||
| ANK repeat | 395..425 | CDD:293786 | 10/29 (34%) | ||
| Bcl3 | NP_291079.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..54 | ||
| ANK | 126..257 | CDD:238125 | 51/157 (32%) | ||
| ANK repeat | 129..164 | CDD:293786 | 10/36 (28%) | ||
| ANK 1 | 129..161 | 10/33 (30%) | |||
| Ank_5 | 152..207 | CDD:290568 | 24/56 (43%) | ||
| ANK 2 | 166..195 | 15/28 (54%) | |||
| ANK repeat | 168..197 | CDD:293786 | 15/28 (54%) | ||
| ANK | 195..324 | CDD:238125 | 46/156 (29%) | ||
| ANK repeat | 199..234 | CDD:293786 | 16/60 (27%) | ||
| ANK 3 | 199..228 | 13/54 (24%) | |||
| Ank_2 | 204..300 | CDD:289560 | 36/123 (29%) | ||
| ANK repeat | 236..267 | CDD:293786 | 10/30 (33%) | ||
| ANK 4 | 236..265 | 9/28 (32%) | |||
| ANK repeat | 270..301 | CDD:293786 | 10/32 (31%) | ||
| ANK 5 | 270..299 | 10/30 (33%) | |||
| Ank_5 | 289..344 | CDD:290568 | 10/44 (23%) | ||
| ANK | 298..>354 | CDD:238125 | 7/33 (21%) | ||
| ANK repeat | 303..334 | CDD:293786 | 6/28 (21%) | ||
| ANK 6 | 303..332 | 6/28 (21%) | |||
| ANK 7 | 333..362 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 356..448 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1341288at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||