DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fzy and fzr

DIOPT Version :9

Sequence 1:NP_477501.1 Gene:fzy / 34968 FlyBaseID:FBgn0001086 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_524852.2 Gene:fzr / 45922 FlyBaseID:FBgn0262699 Length:478 Species:Drosophila melanogaster


Alignment Length:466 Identity:190/466 - (40%)
Similarity:274/466 - (58%) Gaps:43/466 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SNTTPSKTPGGGDRFIPNRAATNFELAHFLVNKDSGDKSDEENDKA--TSSNSNESNVQASAHKG 137
            :|...|.||...|||||.||..|::.....:|| |.|.|.:.:.|.  ....:.:|...:...|.
  Fly    23 NNFESSTTPTSLDRFIPCRAYNNWQTNFASINK-SNDNSPQTSKKQRDCGETARDSLAYSCLLKN 86

  Fly   138 D-RQKLISEVAQVGDSKGGRILCYQNK-APAAPET---HNNPLKVVYSIK-----TPISTKS--- 189
            : ....|.:|...|:.:.      :|. .|||..:   :.:|.|..|:.:     :|:|.||   
  Fly    87 ELLGSAIDDVKTAGEERN------ENAYTPAAKRSLFKYQSPTKQDYNGECPYSLSPVSAKSQKL 145

  Fly   190 ------GSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVALGSCVYLWNAQTGNIEQLTEF 248
                  .:|.|.....::||||:..:|:||||:|||:.|::||.||||||||:|.|..:.:|.:.
  Fly   146 LRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDL 210

  Fly   249 E-EGDYAGSLSWIQEGQILAIGNSTGAVELWDCSKVKRLRVMDGHSARVGSLAWNSFLVSSGSRD 312
            . :.:...|:||.:.|..:|:|...|.|.:||.:..|::..::|||||||:|||||.::||||||
  Fly   211 SPDANTVTSVSWNERGNTVAVGTHHGYVTVWDVAANKQINKLNGHSARVGALAWNSDILSSGSRD 275

  Fly   313 GTIVHHDVRARE-HKLSTLSGHTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASGGVGTATDPLH 376
            ..|:..|.|..: .....|:||.|||||||||.|.:|||||||||.:.||:..|      .:|:.
  Fly   276 RWIIQRDTRTPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHS------VNPVQ 334

  Fly   377 KFNDHQAAVRALAWCPWQPSTLASGGGTADRCIKFWNVNNGTLMKSVDSKSQVCSLLFSRHYKEL 441
            .:.:|.|||:|:||.|.....||||||||||||:|||...|..|:.||:.||||:|.:|:|..||
  Fly   335 SYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSEL 399

  Fly   442 ISAHGFANNQLTIWKYPTMVKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCFAPDPLA 506
            :|.||::.||:.:||||::.:.|.||||:.|||.:|:||||..:::...|||||.||.|:     
  Fly   400 VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS----- 459

  Fly   507 SKKAVSTSKGK 517
              ||.|..:.|
  Fly   460 --KARSQKENK 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fzyNP_477501.1 WD40 <208..500 CDD:225201 145/293 (49%)
WD40 216..498 CDD:238121 138/283 (49%)
WD40 repeat 256..291 CDD:293791 11/34 (32%)
WD40 repeat 297..332 CDD:293791 16/35 (46%)
WD40 repeat 337..373 CDD:293791 20/35 (57%)
WD40 repeat 386..424 CDD:293791 21/37 (57%)
WD40 repeat 429..467 CDD:293791 17/37 (46%)
WD40 repeat 473..513 CDD:293791 17/39 (44%)
fzrNP_524852.2 WD40 <174..469 CDD:225201 149/308 (48%)
WD40 178..456 CDD:238121 138/283 (49%)
WD40 repeat 217..254 CDD:293791 11/36 (31%)
WD40 repeat 260..296 CDD:293791 16/35 (46%)
WD40 repeat 301..337 CDD:293791 21/41 (51%)
WD40 repeat 344..382 CDD:293791 21/37 (57%)
WD40 repeat 387..425 CDD:293791 17/37 (46%)
WD40 repeat 431..457 CDD:293791 13/25 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470611
Domainoid 1 1.000 52 1.000 Domainoid score I2832
eggNOG 1 0.900 - - E2759_KOG0305
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1220675at2759
OrthoFinder 1 1.000 - - FOG0000628
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19918
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.