DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and Cnih4

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_084407.1 Gene:Cnih4 / 98417 MGIID:1925828 Length:139 Species:Mus musculus


Alignment Length:138 Identity:47/138 - (34%)
Similarity:79/138 - (57%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGE 71
            |..::.:|:....|||.:::.:|...:|:.||.|....|:.||..|:||.:.|..:.:|.|....
Mouse     3 AVVFLFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTIVTVLMLVSLH 67

  Fly    72 WFSLCINIPLIAYHIWRYKNRPVMSG-PGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIY 135
            ||...:|:|:..::|:|:...|  || .|::|||.:.....|..:|:|..|||..||:.||.|:|
Mouse    68 WFIFLLNLPVATWNIYRFIMVP--SGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFYLLCFFMYLY 130

  Fly   136 GMVYSLIS 143
            .|:.:||:
Mouse   131 SMILALIN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 43/128 (34%)
Cnih4NP_084407.1 Cornichon 3..130 CDD:308754 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1602458at2759
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101313
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.