DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cni and ERV14

DIOPT Version :9

Sequence 1:NP_001260495.1 Gene:cni / 34967 FlyBaseID:FBgn0000339 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_011461.1 Gene:ERV14 / 852826 SGDID:S000003022 Length:138 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:48/137 - (35%)
Similarity:85/137 - (62%) Gaps:7/137 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGE 71
            |:.:|:|::.:...:|..:...|.:.:|:.||.|||:.|:.:|.|:.||..||..|:||||..|.
Yeast     3 AWLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKVNKLITPEAALHGALSLLFLLNGY 67

  Fly    72 WFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYG 136
            ||...:|:|::||::.:..|:     ..|.|.|.:.:  ||.::.||.::||..:|:.||:|:|.
Yeast    68 WFVFLLNLPVLAYNLNKIYNK-----VQLLDATEIFR--TLGKHKRESFLKLGFHLLMFFFYLYR 125

  Fly   137 MVYSLIS 143
            |:.:||:
Yeast   126 MIMALIA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cniNP_001260495.1 Cornichon 7..135 CDD:281325 44/127 (35%)
ERV14NP_011461.1 Cornichon 3..124 CDD:397410 44/127 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I1772
eggNOG 1 0.900 - - E1_KOG2729
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1491
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000471
OrthoInspector 1 1.000 - - otm46845
orthoMCL 1 0.900 - - OOG6_101313
Panther 1 1.100 - - LDO PTHR12290
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2906
SonicParanoid 1 1.000 - - X297
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.